KEGG   Azorhizobium caulinodans: AZC_4282Help
Entry
AZC_4282          CDS       T00609                                 

Definition
bifunctional pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
azc  Azorhizobium caulinodans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:azc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4874653..4875285
Genome map
AA seq 210 aa AA seqDB search
MMIHDSDTALILVDLQRDFLPGGALAVADGDAVVPLANGLSRRFSNVILTQDWHPAGHIS
FASSHAGHMPFNVITLPYGQQVLWPDHCVQGTEGADFAPGLDVPHAQLVIRKGHHAHIDS
YSTFYEADHHVTTGLTGYLRARGFRRVVLAGLALDFCVGWSALDAARDGFETFVVEEACR
AIDTHGSLHRAREDMARAGVRPLTLTDAGI
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatgatccatgacagcgacaccgccctcatccttgtcgatctccagcgggacttcctg
cccggcggggcgctcgcggttgccgacggtgacgcggtggtgcctctggccaacgggctc
tcccggcgcttctcgaatgtgatcctgacgcaggactggcaccctgccggccacatctcc
ttcgcgtcgagccatgccgggcacatgcccttcaatgtcatcaccctgccctatgggcag
caggtgctctggccggatcactgcgtgcagggcacggagggcgcggacttcgcgccgggc
ctcgatgtgccccacgcgcaactggtgatccgcaagggccaccacgcgcacatcgacagc
tattccaccttctatgaagcggaccatcacgtcaccacgggcctgacaggatacctgcgg
gcgcgcggattccgccgcgtggtgctggccggtctcgccctcgacttctgcgtcggctgg
tccgcccttgatgccgctcgcgacggcttcgagaccttcgtggtggaggaggcctgccgc
gccatcgatacgcacggctcgctccaccgggcgcgggaggacatggcccgcgccggcgta
cgcccactgaccctcaccgacgctgggatctga

DBGET integrated database retrieval system