KEGG   Azorhizobium caulinodans: AZC_4599Help
Entry
AZC_4599          CDS       T00609                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZC_4599
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_4599
   00052 Galactose metabolism
    AZC_4599
   00500 Starch and sucrose metabolism
    AZC_4599
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_4599
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZC_4599
   00524 Butirosin and neomycin biosynthesis
    AZC_4599
Enzymes [BR:azc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AZC_4599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5231956..5232897)
Genome map
AA seq 313 aa AA seqDB search
MVSTALLADIGGTSARIARVDAGGQPYDIRVLAGEDFPNLEALFGHYFEQTGGTRPDVGV
FAVAGPVDGDDVRLTNRDWRFQRPALAAALGLGQLAVFNDFVALAEGVPTLGRADLVQVG
TGKAVERAPILVCGPGTGLGTALLLPQEAGYRVLPSEGGHARFGAVMADEARILAHLVRD
LGSVSVEAVLSGSGLVRLHAVLSGEQCSSQHIIRSALTGSAAELESCNVFLRILGRILGD
YALLFDARGGVFIPGGVAAALAPLFAGSPFRAAFEDHPPYTARLATVPTHVVVHPTPGLA
GAAAIAQRLLAAT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgaccgcattgcttgcagacatcgggggcacctcggcccgcatcgcgcgcgtc
gatgccggcggccagccgtatgacatccgcgtgctcgccggggaggactttcccaatctg
gaagccctgttcgggcattatttcgaacagaccggcggcacccgtcccgatgtcggcgtc
ttcgccgtggccggaccggtggatggcgatgacgtgcgcctgaccaaccgcgactggcgc
ttccagcggccggcgcttgctgcggcactgggtctcggccagctcgccgtgttcaacgat
ttcgtcgcgctggcggagggtgtgccgaccctgggccgcgccgaccttgtgcaggtgggc
accggcaaggccgtggagcgcgcgcccattctggtgtgcggccccggcacgggcctcggc
accgccctgctgctgccgcaggaggccggctaccgcgtgctgcccagcgagggcggccat
gcccgcttcggcgcggtgatggcggatgaggcgcgcatcctcgcccatctggtgcgcgat
ctcggctcggtgagcgtggaggcggtgctgtccggctccggcctcgtgcggctgcacgcg
gtgctttccggcgagcagtgctcctcgcagcacatcatccggtccgcgctgaccggcagc
gccgccgagcttgagagctgcaacgtcttcctgcgcatcctcggccgcatcctcggggat
tatgcgctgctgttcgatgcgcgcggcggcgtcttcattcccggcggcgtcgccgcagct
ctggcaccgctgttcgcgggctcgcccttccgggcggccttcgaggaccatccgccctat
acggcccgcctcgccacggtgccgacccatgtggtggtgcatccgacccccggccttgcc
ggggcggcggccatcgcccagcgcctgctcgcggccacctag

DBGET integrated database retrieval system