KEGG   Azoarcus sp. CIB: AzCIB_0429Help
Entry
AzCIB_0429        CDS       T04019                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
azi  Azoarcus sp. CIB
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:azi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AzCIB_0429
   00630 Glyoxylate and dicarboxylate metabolism
    AzCIB_0429
   00640 Propanoate metabolism
    AzCIB_0429
   00650 Butanoate metabolism
    AzCIB_0429
  Lipid metabolism
   00071 Fatty acid degradation
    AzCIB_0429
   00072 Synthesis and degradation of ketone bodies
    AzCIB_0429
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AzCIB_0429
   00310 Lysine degradation
    AzCIB_0429
   00380 Tryptophan metabolism
    AzCIB_0429
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AzCIB_0429
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AzCIB_0429
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AzCIB_0429
Enzymes [BR:azi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AzCIB_0429
Exosome [BR:azi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AzCIB_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
520072..521010
Genome map
AA seq 312 aa AA seqDB search
MSKVCGSGMKATMLAHDLLVAGTNDVMVAGGMESMSNAPYMLPKARSGYRLGHGQLVDHM
FYDGLEDSYKKETKGRLMGTFAEDCASHFSFTRAAQDEFAIASTTRAQAAIKDGSFAWEV
APVTVSGRKGDVVVDKDEQPPKAQIDKIAGLKPAFSKDGTVTAANSSSISDGAAALVMMR
RSTADKLGLKPLATIVGHATHAQEPAWFTTAPVGAMQKVLAKAGWTKDQVDLWEINEAFA
VVTMAAMKELDLPHDKVNVHGGACALGHPIGASGARILVTLLGALKKYGKKRGVASLCIG
GGEATAVAVELA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaggtgtgcggttcgggcatgaaggcgacgatgctcgcgcacgacctgctcgtg
gctggcaccaacgacgtgatggtcgcgggcggcatggagtcgatgtcgaacgccccctac
atgttgccgaaggcacgcagcggctaccgcctcggccacggccagctcgtcgaccacatg
ttctacgacggcctcgaggacagctacaagaaagaaaccaagggccgcctgatgggcacc
ttcgccgaggattgtgcgagccacttcagcttcacgcgcgccgcccaggacgagttcgcg
atcgcctcgacgacgcgtgcgcaggcagcgatcaaggacggcagcttcgcgtgggaagtc
gcgccggtgacggtgtcgggccgcaagggtgacgtcgtcgtcgacaaggacgagcagccg
ccgaaggcgcagatcgacaagatcgccggcctgaagcccgcattcagcaaggacggcacg
gtcaccgccgcgaactccagctcgatctcggacggtgccgcggcactggtgatgatgcgc
cgctcgaccgccgacaagctgggcctgaagccgctcgcgaccatcgtcggccatgcgacg
cacgcgcaggaaccggcgtggttcacgaccgccccggtcggcgcgatgcagaaagtgctg
gccaaggccggctggacgaaggatcaggtcgacctgtgggagatcaacgaagcctttgcg
gtcgtcacgatggcggcgatgaaggagctcgacctgccgcacgacaaggtgaacgtgcat
ggcggcgcctgcgcgctggggcatccgatcggcgcttcgggcgcgcgcatcctcgtcacg
ctgctcggcgcgctgaagaagtacggcaagaagcgcggcgtcgccagcctgtgtatcggc
ggcggcgaagcgacggcggttgcggtggagctcgcataa

DBGET integrated database retrieval system