KEGG   Azoarcus sp. CIB: AzCIB_2515Help
Entry
AzCIB_2515        CDS       T04019                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00071  Fatty acid degradation
azi00072  Synthesis and degradation of ketone bodies
azi00280  Valine, leucine and isoleucine degradation
azi00310  Lysine degradation
azi00362  Benzoate degradation
azi00380  Tryptophan metabolism
azi00620  Pyruvate metabolism
azi00630  Glyoxylate and dicarboxylate metabolism
azi00640  Propanoate metabolism
azi00650  Butanoate metabolism
azi00900  Terpenoid backbone biosynthesis
azi01100  Metabolic pathways
azi01110  Biosynthesis of secondary metabolites
azi01120  Microbial metabolism in diverse environments
azi01130  Biosynthesis of antibiotics
azi01200  Carbon metabolism
azi01212  Fatty acid metabolism
azi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AzCIB_2515
   00630 Glyoxylate and dicarboxylate metabolism
    AzCIB_2515
   00640 Propanoate metabolism
    AzCIB_2515
   00650 Butanoate metabolism
    AzCIB_2515
  Lipid metabolism
   00071 Fatty acid degradation
    AzCIB_2515
   00072 Synthesis and degradation of ketone bodies
    AzCIB_2515
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AzCIB_2515
   00310 Lysine degradation
    AzCIB_2515
   00380 Tryptophan metabolism
    AzCIB_2515
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AzCIB_2515
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AzCIB_2515
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AzCIB_2515
Enzymes [BR:azi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AzCIB_2515
Exosome [BR:azi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AzCIB_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKU12408
UniProt: A0A0K1J791
Position
2814272..2815477
Genome map
AA seq 401 aa AA seqDB search
MATGIKDKVAIIGMGCSKFGERWDVGPSELLAEAFEEALLDAGIERKQIEAAWYGSCSDP
ISVGNSAIPASMALRLDGIPVSHMENMCATGSEVLRAAAYAVASGAVDFALAIGAEKLKD
TGYGGLPFVYKGTFNDLWLPLGSTPAGFAQLAAGYRAKHGTSKEDLKRAMAHVSWKSHQN
GMLSPKAHLRKAVSMEQILGAPMIADPLGLYDCCGVSDGAAAAIVTTPEIARALGRKDMV
TIKSIQLAIGSGVESGTSQWDGSYVRTTRAAAQKAYAEAGIKDPRSELSLMEVHDCFSIT
ELSTMEDLFVSPDGGAVHDILDGFFDRDGGLPCQVDGGLKCFGHPIAASGLRMAYEIYNQ
LQGRAGERQLSNPSIGLTHNLGGVPYLGIAAISILGLHGGK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgggaatcaaggacaaggtcgccatcatcggcatgggctgctcgaaattcggc
gaacgctgggacgtcggcccctccgaattgctggcggaagccttcgaggaagccctgctc
gatgcgggcatcgaacgtaaacagatcgaggcggcctggtacggctcctgctccgatccg
atcagcgtcggcaactcggccatccccgcctcgatggcgctgcggctggacggcattccg
gtgagccacatggaaaacatgtgcgccaccggcagcgaggtgctgcgcgccgccgcctat
gcggtggccagcggcgcggtggatttcgccctggcgatcggcgcggagaagctcaaggac
accggctacggcggcctgcctttcgtctacaagggaaccttcaacgacctgtggcttccc
ctgggctcgacgccggccggctttgcccaactggccgccggctaccgggccaagcacggc
accagcaaggaagatctgaagcgggcgatggcccacgtttcatggaaaagccatcagaac
ggaatgctcagtccgaaggcccatctgcgcaaggcggtcagcatggagcagatcctcggc
gcccccatgatcgcagacccgctcggcctctacgactgctgcggggtcagcgacggcgcc
gcggcagcgattgtcaccacccccgaaatcgcccgcgccctggggcgcaaggacatggtc
acgatcaagtccatccagttggcgatcggttccggcgtcgagtcgggcacctcccagtgg
gacggcagctatgtgcgcaccacccgggcggcggcgcaaaaagcctacgcggaagccggc
atcaaggaccctcgctcggaactgagcctgatggaagtgcacgactgcttctcgatcacc
gaactgtcgacgatggaggatctgttcgtgtctcccgacggcggcgcggtgcacgacatc
ctcgacggctttttcgaccgggatggcggcctgccctgccaggtggacggcgggctcaag
tgcttcggccacccgatcgccgcctccggcctgcgcatggcctatgaaatctacaaccag
ttgcagggacgggccggcgagcggcagttgagcaatccgagcatcggcctgacccacaac
ctgggcggcgtaccctatctcggcatcgccgcgatttccattctcggcctgcacggcggc
aaatga

DBGET integrated database retrieval system