KEGG   Azoarcus sp. CIB: AzCIB_3296Help
Entry
AzCIB_3296        CDS       T04019                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
azi  Azoarcus sp. CIB
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AzCIB_3296
Enzymes [BR:azi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AzCIB_3296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3695526..3697097)
Genome map
AA seq 523 aa AA seqDB search
MTNGRDAEGRLDRASLLARLRATDAWDVVVIGGGATGLGCAVDASSRGHRTLLLEAHDFA
KGTSSRATKLIHGGVRYLAQGNLPLVHEALAERSRLLANAPHLVHKLRFVVPAYHWLDIP
KFGAGLAFYDLLSGMHGIGHSRVLDAASTIVALPTLKPGGLRGGIAYWDAQFDDARLALA
LMRTHFDQGGLALNYLPVDGLVVEDGQVSGVLAHDAETGETFRIAAGVVVNATGVWADAI
RRAELPQVRPLLKPSQGVHVVVDAEFLPGRDALLVPQTADGRVLFVIPWQGRVLIGTTDS
PRQDLPLEPQPLAGEIDFILDAVAPYLVRPPSRADIRSVFVGLRPLIGAGDRSATRSLSR
EHCIEVSPGGLVTITGGKWTTYRRMAEETVDTAQSVAGLSRRPCVTAELRLHGAEAGASS
DPYGSARASVDALPGAGRPVHAGLRLTEAEVRYAARCELARGVEDVLARRYRALFLDAAG
AVAAAPQVARLLAEELGKDAAWCEAEVGRFGALARQYGRPEEE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacggcagggacgcggagggccggctcgatcgggcgtcgctgctcgcgcgcttg
cgcgcgaccgatgcgtgggacgtcgtcgtgatcggcggcggggcgacggggctgggctgc
gccgtcgatgcgagttcgcgcgggcaccgcacgctgctgctcgaggctcatgacttcgcg
aaagggaccagctcgcgcgcgaccaagctgatccacggcggcgtgcgctacctcgcgcag
ggcaatcttccgctcgtgcacgaggccctcgccgagcgttcgcgcctgctcgcgaacgct
ccgcatctggtacacaagttgcgcttcgtcgttccggcctatcactggctggatatcccc
aagttcggcgccggcctcgcgttctacgacctgctgtcgggtatgcacggcatcggccac
agccgcgtgcttgacgccgcgagtaccatcgtcgccctgccgacgctcaagcccggcggc
ctgcgcggaggcatcgcctactgggacgcccagttcgacgacgcgcgccttgcgctggcc
ttgatgcgcacgcatttcgaccagggtgggctcgcgttgaactatcttcccgtcgacggc
ctggtcgtcgaggacggacaggtgagcggcgtcctcgcgcacgacgccgagaccggcgag
acgttccgcatcgcggcgggggtcgtcgtcaacgcgaccggcgtgtgggccgacgccatc
cgccgtgcggagctcccgcaggtgcgtcccttgcttaaacccagccagggcgtgcatgtc
gtcgtggatgcggaattcctccccggacgcgatgcgctgctggtgccgcaaaccgccgac
ggacgcgtcctgttcgtaattccgtggcaggggcgggtgctgatcggcaccacggattcg
ccaaggcaggacctcccgctggagccgcagccgctcgcgggcgagatcgatttcatcctc
gacgccgttgcgccctatctcgtgcggccgccctcgcgcgcggacatccgcagcgtcttc
gtcggcctgcgtccgctcatcggcgcgggcgaccgttccgccacccgcagcctgtcgcgc
gagcactgcatcgaggtgtcgccgggcggactggtgacgatcaccggcgggaaatggacg
acctatcgccgcatggccgaggagaccgtcgataccgcgcagtcggttgccggcctgtcg
cgccgtccgtgcgtcaccgccgagctgcgtctgcacggcgcggaggcgggggcctcgtcc
gatccctatggttcggcgcgcgcctccgtggacgcgttgcccggtgccggacgccccgtg
catgcgggtttgcgcctgaccgaagccgaagtgcgctacgctgcgcgctgcgagctcgcc
cgcggcgtggaggacgtgctggcgcgtcggtaccgcgcgctgttcctcgacgccgccgga
gcggtggccgctgcgccgcaggtcgcgcgcctgcttgcagaggaactgggaaaggatgcg
gcctggtgcgaggccgaggtggggcgcttcggcgcactcgcccggcaatacggccggccc
gaagaagaataa

DBGET integrated database retrieval system