KEGG   Azospirillum sp. B510: AZL_000330Help
Entry
AZL_000330        CDS       T01169                                 

Definition
SGNH hydrolase-type arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
azl  Azospirillum sp. B510
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AZL_000330
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AZL_000330
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AZL_000330
Lipid biosynthesis proteins [BR:azl01004]
 Fatty acid synthase
  Component type
   AZL_000330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
33720..34451
Genome map
AA seq 243 aa AA seqDB search
MRHSHKRNGPSPYGTARRAFNSGALGAALAFLLTAGISMTVPTPAAAQPVKLLALGDSLT
AGYGLPEPQGFTRQLEKALAAKGYGVTVINAGVSGDTTAGGRARLDWALADRPDAAIVEL
GANDMLRGLDPGQARANLDAILKSLTERKIPTLLAGMYASPSLGKPYTDSFNAIYPDLAK
SHNLPLYPFFLDGVALRQALFQPDGLHPNAQGVAVIVERILPSVTALLDSLPRMRKTGEK
TGG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgacactcgcacaagcggaatggaccatcgccatatggcacggcccgccgggctttc
aactcgggcgcgcttggcgccgcgctggccttccttctcaccgcagggatatcgatgacc
gttccgacccccgccgccgcccagccggtgaagctgctggcgctgggcgacagcctgacc
gccggctatggcttgccggaaccgcagggcttcacccgccagttggaaaaggcgctggcc
gccaagggctacggcgtcaccgtgatcaatgccggcgtgtcgggcgacaccaccgccggc
ggccgggcgcggctcgattgggcgctggccgatcggccggacgccgccatcgtcgagctg
ggcgccaacgacatgctgcgcgggctcgatcccggtcaggccagggccaacctcgacgcc
atcctgaagagcctgacggagcgcaaaatcccgacgctgctggccggcatgtacgcctcc
cccagcctgggcaagccctacaccgacagcttcaacgccatctatcccgatctggcgaag
agccacaacctgccgctctatcccttcttcctcgacggggtggcgttgcggcaggcgctg
ttccagccggacgggctgcaccccaacgcccagggcgtggcggtgatcgtggagcgcatc
ctgccttccgtcaccgccctgctcgacagcctgccgcggatgcggaagactggcgaaaag
accggaggctga

DBGET integrated database retrieval system