KEGG   Azospirillum sp. B510: AZL_001740Help
Entry
AZL_001740        CDS       T01169                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
azl  Azospirillum sp. B510
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZL_001740 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZL_001740 (sdhD)
   00650 Butanoate metabolism
    AZL_001740 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AZL_001740 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
192773..193168
Genome map
AA seq 131 aa AA seqDB search
MASNSKTLRSPLQVARGLGSAKHGTEHWWSQRLTAIALVPLTVWFVFGVIGHLGADHAAF
VAWMKSPFSAVMMVLTAVVTFHHAQSGLQVVIEDYVNVEWQKMALIIGVKFLSFALAAAC
VLAVVKIFIGA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaatagcaagaccctccgctcgccgctgcaggtcgcgcgcggtctgggttcc
gccaagcatggcaccgaacattggtggtcgcagcgcctgaccgcgatcgcgctcgtcccg
ctgaccgtctggttcgtcttcggcgtcatcggccatctcggcgccgatcacgccgccttc
gtcgcctggatgaagtcgcccttctcggccgtcatgatggtcctcaccgccgtggtcacc
ttccaccatgcccagtcggggttgcaggtggtcatcgaggactatgtgaatgtcgaatgg
cagaagatggcgctgatcatcggcgtcaagttcctgtccttcgccctggcggcagcctgc
gtgctggccgtcgtgaagatcttcatcggagcctga

DBGET integrated database retrieval system