KEGG   Azospirillum sp. B510: AZL_002250Help
Entry
AZL_002250        CDS       T01169                                 

Definition
type III restriction enzyme res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     AZL_002250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
247582..250617
Genome map
AA seq 1011 aa AA seqDB search
MSEAFFERPILNSPYAYPARHWELDADGQPTNRIVEHRRRSELISPIPKTKKRRSPTQAN
LDLDHTANLTHDGQEYNPTPYINKIRNEVESWRRLPNPNDWGVTPETARLLQHWRHHPFQ
GVRPFFCQIEAVETAIWLTEVAPQRGEIWQHIKRANQQANPELLRMALKLATGAGKTTVM
AMLIAWQTVNAVRHPNAKSFSRGFLIVAPGITIRDRLRVLLPNDPESYYRNREIVPGDML
ADIERAKIVITNYHAFKRRERMEVSKVGRALLKGRGPDLDTLETEGQMLQRVMPDLMGLK
SIVVLNDEAHHCYREKPPEQGGTDGVADLKGDEKDEAKRNNEAARLWISGLETVKRKLGL
RAVYDLSATPFFLNGSGYAEGTLFPWTVSDFSLMDAIECGIVKLPRVPVADNIPGADVPK
FRDLWTHIGKRMPKAGRGAGKTLDPLAIPVELQTALEALYGHYAKTFDLWEQAGIGVPPV
FIVVCNNTATSKLVHDYISGFHRPNPDGSATLENGRLPLFRNFDEFGNRLARPRTLLIDS
EQLESGEALDKDFRALAGDEIERFRREIVERTGDIRKGEAITDQDLLREVMNTVGKKGKL
GESIRCVVSVSMLTEGWDTNTVTHVLGVRAFGTQLLCEQVVGRALRRQSYDLNGEGLFNV
EYADVLGVPFNFNAKPVIAPPAKPRETVTVQAVRPDRDALEITFPRVEGYRVELPEERLT
AAFGPDSVLDLNPDLVGPSVTQNRGIIGEGVDLTVAHLEDMRQSTILFHLARHLLFQKFR
DPGAEPKLHLFGQLKRITKQWLDGGYLRCTGGTYPAQVIYREIADMAAERITAAITLAHV
GDRPVKAVLDSYNPKGSTAFVSFTTSKTTRWQTDPRKCHINWVVCDSDWEAELCRVVEAH
PRVLSYVKNHVLGFEVPYRHGSTPRRYLPDFIVRIDDGRGAQDPLNLIVEVKGYRGEDAK
DKADTMRAYWVPGVNNLGSFGRWAFVEFTAVYEMETAFAALVDGFISETVV
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcgtttttcgagcggccgatcctgaactcgccctatgcctaccccgcccgc
cactgggaactggacgccgacggccagccgacgaaccggatcgtcgagcatcgccgccgc
tcggaactcatcagcccgatcccgaagaccaagaagcgtcgcagcccgacccaggcgaac
ctcgacctcgaccacacggccaacctgacccatgacgggcaggagtacaatccaaccccc
tacatcaacaagatccgcaacgaggtcgaatcctggcggcggctgcccaaccccaacgac
tggggcgtgacgccggaaaccgcccgcctgctccagcattggcgccaccatccgtttcag
ggcgtccgtcccttcttctgccagatcgaggcggttgaaaccgcgatctggttgaccgag
gtcgccccgcagcgcggcgagatttggcagcacatcaagcgtgccaaccagcaggccaac
ccggaactgctgcgtatggcgctgaagctcgccaccggcgcgggcaagaccaccgtcatg
gcgatgctgatcgcgtggcagacggtcaacgccgtccggcacccgaacgccaagtccttc
tcgcgcggcttcctgatcgtggcgcccggcatcaccattcgtgaccggctgcgcgtgctg
ctccccaacgaccccgagagctactaccgcaaccgcgagatcgttccgggcgacatgctc
gccgacatcgagcgggccaagatcgtcatcacgaactaccacgccttcaagcggcgcgag
cgcatggaggtttcgaaggtcgggcgcgcgctgctcaaggggcgtggccctgatctggac
acgctggaaaccgaaggccagatgctccagcgcgtgatgccggacctgatgggcctgaaa
agcatcgtcgtgctgaacgacgaggcccaccactgctaccgcgagaagccccccgaacag
ggcggcaccgatggcgtcgccgacctgaaaggcgacgagaaggacgaggccaagcgcaac
aacgaggccgcccgcctgtggatctccgggctggagacggtcaagcgcaagctgggcctg
cgcgccgtctacgacctgtcggccacgcccttcttcctgaacggctccggctacgccgag
ggaaccctgttcccgtggacggtcagcgacttctcgctgatggacgccatcgagtgcggc
atcgtcaagctgccccgcgtgccggtggccgacaacatccccggcgccgacgtgccgaag
ttccgcgacctgtggacccacatcggcaagcgcatgcccaaggccgggcgcggtgctggc
aagacgctcgacccgctggcgatcccggtggagcttcagaccgcgctggaggcgctctac
ggccattacgccaagaccttcgacctgtgggagcaggcggggatcggcgtgccgccggtc
ttcatcgtcgtctgcaacaacaccgccacatcgaagctggtgcatgactacatctccggc
ttccaccgtcccaaccccgacggctcggcgacgctggagaacgggcgcctgcccctgttc
cgcaatttcgacgagttcggcaaccggctggcccggccgcgcaccctgctgatcgacagc
gaacagttggagtccggcgaggcgcttgacaaggatttccgcgccttggcgggcgacgag
atcgagcggttccgccgcgagattgtcgagcgcaccggcgacatccgcaagggcgaggcg
atcaccgaccaagaccttctgcgcgaggtgatgaacaccgtcggcaagaagggcaagctc
ggcgagtcgatccgctgcgtcgtctccgtctccatgctgacggaaggatgggacaccaac
accgtcacccatgtgctgggcgtccgcgcgttcggcacgcagttgctctgcgaacaggtg
gtcggccgcgccctgcggcgccagtcctacgacctgaacggcgaagggctgttcaacgtc
gaatatgccgacgtgctgggcgtgccgttcaatttcaacgccaagccggtcatcgccccg
cccgccaagccgcgcgagacggtgacggtccaggcggtccgccccgaccgcgacgcgctg
gaaatcaccttcccccgcgtcgagggctaccgcgtcgaactgccggaggagcggctgacc
gccgccttcggcccggactcggtgctcgacctcaaccccgatctggtcggcccgtccgtc
acccagaaccggggcatcatcggcgagggcgtggacctgaccgtcgcccatctggaggac
atgcgccagtccaccatccttttccatctggcccgccatctgctgttccagaagttccgc
gatccgggcgcggagccgaagctccacctgttcggccagttgaagcggatcaccaagcaa
tggcttgacggcggctatctgcgctgcaccggcggcacctacccggcgcaggtgatctac
cgggagatcgccgacatggcggcggagcgcatcaccgccgccatcacgctggcgcatgtc
ggcgaccggccggtcaaggcggtgctcgacagctacaaccccaaaggctccaccgccttc
gtcagcttcaccacgtcgaagaccacgcgctggcagaccgacccgcgcaaatgccacatc
aattgggtggtctgcgacagtgattgggaggcggaactgtgccgggtggtggaagcccat
ccgcgcgtcctgtcctatgtgaagaaccacgtcctgggcttcgaggtgccgtatcgccac
ggctccaccccgcgccgctacctaccggacttcatcgtccgcatcgacgacgggcgcggc
gcgcaagatccgctgaacctgatcgtcgaggtcaagggctatcgcggcgaggacgccaag
gacaaggcggacaccatgcgcgcctattgggtgccgggggtgaacaacctgggcagcttc
ggccgctgggccttcgtcgagttcaccgccgtctatgagatggaaacagcgttcgcggcg
ctggtggatggctttatttccgagaccgtggtgtaa

DBGET integrated database retrieval system