KEGG   Azospirillum sp. B510: AZL_002850Help
Entry
AZL_002850        CDS       T01169                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
azl  Azospirillum sp. B510
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZL_002850 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_002850 (glk)
   00052 Galactose metabolism
    AZL_002850 (glk)
   00500 Starch and sucrose metabolism
    AZL_002850 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AZL_002850 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZL_002850 (glk)
   00524 Butirosin and neomycin biosynthesis
    AZL_002850 (glk)
Enzymes [BR:azl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AZL_002850 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(318339..319316)
Genome map
AA seq 325 aa AA seqDB search
MAADPAPILVADIGGTNARFGLIDGRILRDTRVLRCADYASIEDAATAYLSAVGLAAPGT
PGRPRRGAFAVAGPVTGDHIAMTNLVWQFSVKRVRDALALDGLAVINDFTAVALSVPRLA
EEDRRQIGDGAAQPGAVVGVLGPGSGLGLSGLVPGANGRWTALSGEGGHATMAPMSDRES
AVLDQLRKSFEHVSAERVLSGPGLVNLYNALMILDGREPAALTPAQVADSAIGGGDPHCV
EAVEMFCAMLGTVAGNLALTLGARGGIYIAGGIVPKLGPLFTHSRFRKRFMEKGRMHDFL
APIPTYVITHELPAFLGLAEAAGAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgaccccgcccccattctcgtcgccgacatcggcggcaccaatgcccgtttc
ggcctgatcgacggccggatcttgcgcgacacccgcgtcctgcgctgcgccgactacgcc
tcgatcgaggatgcggccaccgcctatctgtcggccgtcgggctggcggcgcccggcact
ccaggccggccgcggcgcggcgccttcgccgtggccggtccggtcaccggcgaccacatc
gccatgaccaatctggtctggcaattctcggtcaagcgggtgcgcgacgccctcgcgctg
gatggtctggccgtcatcaatgatttcaccgccgtcgccctgtcggtgccgcgtctggcg
gaggaggaccggcgccagatcggcgacggcgcggcacagccgggcgccgtcgtcggcgtg
ctgggaccgggcagcgggctgggcctgtccggactggtgccgggggcgaacggccgctgg
accgcgctgtcgggcgagggcggccatgccaccatggcgccgatgagcgaccgcgaaagc
gccgttctggaccagctgcgcaagagcttcgaacatgtctcggccgagcgggtgctgtcc
gggccgggcctcgtcaatctctataacgcgctgatgatcctggacgggcgggagccggcc
gccctgaccccggcccaggtggcggacagcgcgatcggcggcggcgatccccactgcgtc
gaggcggtggagatgttctgcgccatgttgggcaccgtcgccggcaacctcgccctgacg
ctgggcgcgcgcggcggcatctacatcgccggcggcatcgtgccgaagctggggccgctg
ttcacccactcccgcttccgcaagcgcttcatggagaaggggcgcatgcacgacttcctg
gcgccgatccccacctatgtcatcacccacgagctgcccgccttcctgggactggccgaa
gccgcgggggcggagtag

DBGET integrated database retrieval system