KEGG   Azospirillum sp. B510: AZL_004030Help
Entry
AZL_004030        CDS       T01169                                 

Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
azl  Azospirillum sp. B510
Pathway
azl00860  Porphyrin and chlorophyll metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZL_004030
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AZL_004030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAI71041
RhizoBase: AZL004030
UniProt: D3NRL2
Position
complement(456448..457227)
Genome map
AA seq 259 aa AA seqDB search
MTEKQPARPVPSPSRPRTRLLVTRPAEDAEPLVRRLEALGHDTAVEPMLSMVWLDGPEPD
LSDVQALLFTSANGVRAYSKRTSRRDRPVHAVGDATARAARAAGFTMVDSASGDVYALAG
RVRALRDPSAGTLLHVAGSKVAGDLAGLLGAAGFMLRRSVMYDAVPALTLSDETATFLRT
SGLDGVLFFSPRTASSFVRLLAGAGLVDRCRTVDAFCLSPAVAEAACAYGDGGAVPWKSV
RVAARPEQDSLLDLLPVAG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaagcagcccgcccgtcccgtcccgtccccgtcccgcccccgtacgcgtctg
ctggtgacgcgtccggcggaggacgccgagccgctggtccggcggctggaggcgctcggc
cacgacacggcagtggaaccgatgctgtcgatggtctggctcgacgggccggagcccgac
ctttccgacgtacaggcgctgctcttcaccagcgcgaacggcgtacgggcatactccaaa
cgtacgagccggcgcgaccgtccggtgcacgccgtcggcgacgccacggcgcgggcggcg
cgggccgccggcttcaccatggtcgacagcgcgtcgggcgacgtgtacgcgctggccggg
cgcgtccgcgccctgcgcgatccgtccgccggtacgctgctgcatgtggcgggaagcaag
gtcgccggcgaccttgccggcttgctgggcgccgccggcttcatgctgcggcgcagcgtg
atgtacgacgccgtacccgcgctaaccctgtcggatgagaccgcgacatttttgcgtacg
tccggtttggacggcgtgctgtttttctctccccgtaccgcttcatcctttgttaggttg
ctggccggggcgggactggtcgatcgttgtcgtacggtcgacgcgttctgcctcagcccc
gcggtcgcggaggctgcctgtgcgtacggcgacgggggagcggtgccgtggaagagcgta
cgggtggcggcgcggccagagcaggactccctgctcgatctgttgccggtcgccgggtaa

DBGET integrated database retrieval system