KEGG   Azospirillum sp. B510: AZL_004350Help
Entry
AZL_004350        CDS       T01169                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
azl  Azospirillum sp. B510
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:azl00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:azl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
491306..491845
Genome map
AA seq 179 aa AA seqDB search
MSMEWNKIFGAVLLAGLIAMLAGFASKVLVHSKPLEKSVYVVATPEGASAPADKGAAPTG
PAPIAPLLAAASPDAGQKVAKACAACHSFDKGGAAKVGPNLYGVVGGPKGHMSGFGYSDA
LVKTGGSWSYDELNKFLYDPKAYAPGTKMTFAGLKKDEDRAAVIAYLRSLADSPQPLPQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagtggaacaagattttcggcgccgtgctgctggccgggctgatcgcgatg
ctggcaggattcgcgtccaaggtgctggttcattcgaagccgctcgaaaagagcgtctat
gtcgtcgcgacgcccgagggggcaagcgcgcccgccgacaagggtgccgctcccaccggc
ccggcgccgatcgcgccgctgctcgccgccgccagcccggacgccggccagaaggtcgcc
aaggcctgcgccgcctgccacagcttcgacaagggcggtgccgccaaggtcggacccaac
ctgtatggcgtcgtcggcggcccgaaggggcacatgtcgggcttcggttactccgacgcg
ctggtcaagaccggcggcagctggagctatgacgagctgaacaagttcctctatgatccg
aaggcctatgccccggggaccaagatgaccttcgccggtctgaagaaggacgaggaccgc
gccgccgtcatcgcctatctgcgctcgctggccgacagcccgcagccgctgccgcaataa

DBGET integrated database retrieval system