KEGG   Azospirillum sp. B510: AZL_006260Help
Entry
AZL_006260        CDS       T01169                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
azl  Azospirillum sp. B510
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AZL_006260 (pldB)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AZL_006260 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
705304..706269
Genome map
AA seq 321 aa AA seqDB search
MEPRHVVMRDIAMRDGARLRVAVWPVPRRVHGTALVLTGRAEFIEKYAETAAALAARGFR
VVAVDWRNQGLSDRPLPNRQIHHLTDFATLVDDLDELHRQVVAPVAAETGGPLILLAHSM
GALVATLALARHCDDDPGRYAAVLLSAPMYAVNSAPLPRWLMRGLAALALACGLGTRYAL
GQGDYDPANGRFRPGNRITSDPRRYAAFHGPYAARPELRVGGVSFAWVAAALDAEDALRH
ALPLERVRTPVLLLSPPDDRVVRAEAHHAVAARLGNAHLIDYPGARHELLMECDAIRDRV
WADIDAFLDKTLAPDGGPVVG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccgcgccatgtcgtgatgcgcgatatcgcgatgcgtgacggggcgcggctgcgc
gtcgccgtctggccggtgccgcggcgggtccacggcacggccctggtgctgaccgggcgg
gcggagttcatcgagaaatatgccgagaccgcggccgcgctcgccgcccgcggctttcgc
gtggtggcggtcgactggcgcaaccagggcctgtccgaccggccgctgcccaaccggcag
attcatcatctgaccgatttcgcgacgctggtggacgatctcgacgagctccatcggcag
gtggtggcgccggtggcggcggagacgggcggaccgctgatcctgctggcccactcgatg
ggcgcgctggtggcgactctggcgctggcccgccattgcgacgacgatcccggccgctat
gccgccgtgctgctctcggcgccgatgtacgccgtcaacagcgcgccgctgccgcgctgg
ctgatgcgggggctggccgctctcgccctcgcctgcggcttgggcacgcgctacgcgctg
gggcagggcgattacgatccggcgaatgggcgcttccggccgggcaaccggatcacctcc
gatccccggcgctatgccgccttccatggcccctatgccgcgaggccggagctgcgcgtc
ggcggcgtcagcttcgcctgggtcgccgccgccctggatgccgaggatgcgctccgccat
gccctgccgctggagcgggtgcgcacgccggtgctgctgctgagcccgccggacgaccgg
gtcgtgcgggccgaggcgcaccacgcggtggccgcgcggctcggcaacgcccatctgatc
gactatccgggggcgcggcacgagctgctgatggagtgcgacgccatccgcgaccgggtg
tgggcggacatcgacgccttcctcgacaagacgcttgcgcccgatggcggccccgtcgtc
ggatag

DBGET integrated database retrieval system