KEGG   Azospirillum sp. B510: AZL_007340Help
Entry
AZL_007340        CDS       T01169                                 

Gene name
fucA
Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
azl  Azospirillum sp. B510
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AZL_007340 (fucA)
Enzymes [BR:azl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AZL_007340 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
835252..835941
Genome map
AA seq 229 aa AA seqDB search
MTTHLADRQAVIDGCLAMNRLGVNQGMSGNLSRRIDGGFLVTPTSMPYDALTPADIVEMG
FDGTYLGERRPSSEWRIHRDILRARPDICVVLHAHPTFATALAVHGRGIPSFHYMVALAG
GDSIRCAPYATFGTQELSDHALAALEGRLACLLANHGMIVLGTSVQSALALAVEVETLAR
QYLHAQQFGEPVILPPDEIARVAEKMRRMKYGQPIDDADAPEDTARPRL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacctcgccgaccgtcaggccgtcatcgacggctgcctcgccatgaaccgg
ctgggcgtcaatcagggcatgtctggcaacctgtcgcggcggatcgatggcggtttcctg
gtcaccccgaccagcatgccctatgacgcgttgacccccgccgacatcgtcgagatgggg
ttcgacggcacctatctcggcgagcgccgcccctcgtcggaatggcgcatccaccgcgac
atcctgcgggcgcggccggacatctgcgtcgtcctgcatgcccacccgaccttcgccacc
gcgctggcggtgcatgggcgcggtatcccgtccttccattacatggtggcgctggccggt
ggcgactcgatccgttgcgctccctacgccaccttcggcacccaggaactgtccgaccat
gccctggcggcgctggaggggcggttggcctgcctgctggccaatcacggcatgatcgtg
ctgggcaccagcgtccagtccgccctggcgctggcggtcgaggtcgagacgctggcccgc
caatatctccatgcccagcagttcggcgagccggtgatcctgccgcccgacgagatcgcc
cgggtggcggagaagatgcggcggatgaaatacggccagccgatcgacgatgcggacgcg
ccggaagacaccgcccggccgcgtctgtga

DBGET integrated database retrieval system