KEGG   Azospirillum sp. B510: AZL_007700Help
Entry
AZL_007700        CDS       T01169                                 

Gene name
nifD
Definition
nitrogenase molybdenum-iron protein subunit alpha
Orthology
K02586  
nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
azl  Azospirillum sp. B510
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:azl00910]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:azl00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(871204..872643)
Genome map
AA seq 479 aa AA seqDB search
MSLSENTTVDVKNLVNEVLEAYPEKSRKRRAKHLNVLEAEAKDCGVKSNVKSIPGVMTIR
GCAYAGSKGVVWGPIKDMIHISHGPVGCGYYSWSGRRNYYIGDTGVDSWGTMHFTSDFQE
KDIVFGGDKKLHKVIEEINELFPLVNGISIQSECPIGLIGDDIEAVARAKSAEIGKPVIP
VRCEGFRGVSQSLGHHIANDAIRDWVFEKTEPKADFVSTPYDVTIIGDYNIGGDAWSSRI
LLEEIGLRVIAQWSGDGTLAELENTPKAKVNLIHCYRSMNYIARHMEEKFNIPWMEYNFF
GPSQIAESLRKIAALFDDKIKENAERVIARYQPLIDAVIAKYKPRLNGKKVMIYVGGLRP
RHVVDAYHDLGMEIIGTGYEFAHNDDYQRTPHYVKEGTLIYDDVTAFELEKFVEALRPDL
VASGIKEKYVFQKMGLPFRQMHSWDYSGPYHGYDGFAIFARDMDLAINNPVWGVMKAPF
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtccgagaacaccacggtcgacgtcaagaacctcgtcaacgaagtcctcgaa
gcctatcccgaaaaatcccgcaagcgccgcgccaagcacctgaacgtgctggaggcagag
gccaaggactgcggcgtcaagtcgaacgtcaagtccatccccggcgtcatgaccatccgc
ggctgcgcctatgccggctccaagggcgtggtgtggggtccgatcaaggacatgatccac
atctcccacggtccggtcggctgcggctattattcctggtccggccgccgcaactactac
atcggcgacaccggtgtcgacagctggggcacgatgcacttcacctccgacttccaggag
aaggacatcgtcttcggcggcgacaagaagctgcacaaggtcatcgaggaaatcaacgag
ctgttcccgctggtgaacggcatctcgatccagtcggaatgcccgatcggcctgatcggc
gacgacatcgaggcggtcgcccgcgccaagtcggccgaaatcggcaagccggtcatcccc
gtgcgctgcgaaggcttccgtggcgtgtcccagtcgctgggccatcacatcgccaacgac
gccatccgcgactgggtgttcgagaagacggaacccaaggccgatttcgtctccaccccc
tatgacgtcaccatcatcggcgactacaacatcggcggcgacgcctggtcgtcccgcatc
ctgctggaggagatcggcttgcgcgtgatcgcccaatggtcgggcgacggcacgctggcc
gagttggagaacacgccgaaggccaaggtcaacctgatccactgctaccgctcgatgaac
tacatcgcgcgccacatggaggagaagttcaatattccgtggatggaatacaacttcttc
ggcccgagccagatcgccgagtccctgcgcaagatcgccgctctcttcgacgacaagatc
aaggagaacgccgagagggtcatcgcccgttaccagccgctgatcgacgcggtcatcgcc
aagtacaagccgcggctcaacggcaagaaggtgatgatctatgtcggcggcctgcgtccg
cgccacgtcgtcgacgcctaccatgacctcggcatggagatcatcggcaccggttacgag
ttcgcccacaacgacgattatcagcgcacgccgcactatgtgaaggaaggcacgctgatc
tacgacgacgtcaccgcgttcgaactggagaagttcgtcgaggcgctgcgtcccgacctc
gtcgcgtcgggcatcaaggaaaaatacgtgttccagaagatgggcctgccgttccgccag
atgcacagctgggattattccggcccgtatcacggctatgacggcttcgcgatcttcgcc
cgcgacatggacctggccatcaacaaccccgtctggggcgtgatgaaggccccgttctga

DBGET integrated database retrieval system