KEGG   Azospirillum sp. B510: AZL_007700Help
Entry
AZL_007700        CDS       T01169                                 

Gene name
nifD
Definition
nitrogenase molybdenum-iron protein subunit alpha
Orthology
K02586  
nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
azl  Azospirillum sp. B510
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AZL_007700 (nifD)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZL_007700 (nifD)
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     AZL_007700 (nifD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(871204..872643)
Genome map
AA seq 479 aa AA seqDB search
MSLSENTTVDVKNLVNEVLEAYPEKSRKRRAKHLNVLEAEAKDCGVKSNVKSIPGVMTIR
GCAYAGSKGVVWGPIKDMIHISHGPVGCGYYSWSGRRNYYIGDTGVDSWGTMHFTSDFQE
KDIVFGGDKKLHKVIEEINELFPLVNGISIQSECPIGLIGDDIEAVARAKSAEIGKPVIP
VRCEGFRGVSQSLGHHIANDAIRDWVFEKTEPKADFVSTPYDVTIIGDYNIGGDAWSSRI
LLEEIGLRVIAQWSGDGTLAELENTPKAKVNLIHCYRSMNYIARHMEEKFNIPWMEYNFF
GPSQIAESLRKIAALFDDKIKENAERVIARYQPLIDAVIAKYKPRLNGKKVMIYVGGLRP
RHVVDAYHDLGMEIIGTGYEFAHNDDYQRTPHYVKEGTLIYDDVTAFELEKFVEALRPDL
VASGIKEKYVFQKMGLPFRQMHSWDYSGPYHGYDGFAIFARDMDLAINNPVWGVMKAPF
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtccgagaacaccacggtcgacgtcaagaacctcgtcaacgaagtcctcgaa
gcctatcccgaaaaatcccgcaagcgccgcgccaagcacctgaacgtgctggaggcagag
gccaaggactgcggcgtcaagtcgaacgtcaagtccatccccggcgtcatgaccatccgc
ggctgcgcctatgccggctccaagggcgtggtgtggggtccgatcaaggacatgatccac
atctcccacggtccggtcggctgcggctattattcctggtccggccgccgcaactactac
atcggcgacaccggtgtcgacagctggggcacgatgcacttcacctccgacttccaggag
aaggacatcgtcttcggcggcgacaagaagctgcacaaggtcatcgaggaaatcaacgag
ctgttcccgctggtgaacggcatctcgatccagtcggaatgcccgatcggcctgatcggc
gacgacatcgaggcggtcgcccgcgccaagtcggccgaaatcggcaagccggtcatcccc
gtgcgctgcgaaggcttccgtggcgtgtcccagtcgctgggccatcacatcgccaacgac
gccatccgcgactgggtgttcgagaagacggaacccaaggccgatttcgtctccaccccc
tatgacgtcaccatcatcggcgactacaacatcggcggcgacgcctggtcgtcccgcatc
ctgctggaggagatcggcttgcgcgtgatcgcccaatggtcgggcgacggcacgctggcc
gagttggagaacacgccgaaggccaaggtcaacctgatccactgctaccgctcgatgaac
tacatcgcgcgccacatggaggagaagttcaatattccgtggatggaatacaacttcttc
ggcccgagccagatcgccgagtccctgcgcaagatcgccgctctcttcgacgacaagatc
aaggagaacgccgagagggtcatcgcccgttaccagccgctgatcgacgcggtcatcgcc
aagtacaagccgcggctcaacggcaagaaggtgatgatctatgtcggcggcctgcgtccg
cgccacgtcgtcgacgcctaccatgacctcggcatggagatcatcggcaccggttacgag
ttcgcccacaacgacgattatcagcgcacgccgcactatgtgaaggaaggcacgctgatc
tacgacgacgtcaccgcgttcgaactggagaagttcgtcgaggcgctgcgtcccgacctc
gtcgcgtcgggcatcaaggaaaaatacgtgttccagaagatgggcctgccgttccgccag
atgcacagctgggattattccggcccgtatcacggctatgacggcttcgcgatcttcgcc
cgcgacatggacctggccatcaacaaccccgtctggggcgtgatgaaggccccgttctga

DBGET integrated database retrieval system