KEGG   Azospirillum sp. B510: AZL_007930Help
Entry
AZL_007930        CDS       T01169                                 

Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AZL_007930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
897129..898277
Genome map
AA seq 382 aa AA seqDB search
MTGRFRRILAAGVAVLAPVLGLATAMPVLAADWTWSLPGHVPEPRVPADNPMSAVKVELG
RRLFYDTRLSGNGTIACASCHIQAKAFTDGRALSPGSTGGLTHRNAQPLANSAWNATYTW
ANPALVSLERQMEVPLFGDDPVEMGVTDANRAAILERLRADPVYPPLFRQSFPDEAEPLT
MATVIKAIAAFQRGIVSVDSRYDRYLQGKASLSEAETRGMALFFGERAECHHCHGSFNFN
DQVVHARSREVETPFHNTGLYNLDGAGAYPFPNRGLFEFTAKPEDMGAFRAPSLRNVAVT
GPYMHDGGIATLAAVIDAYSDGGRAVRSGPLKGDGRLNPHKSGLISRIGLTPQEKRDLLA
FLGALTDETLLTDPRWSDPWKK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccggttccggcgcatcctggccgcaggagtcgccgtcctcgcgcccgtcctc
gggttggcgacggcgatgccggtcctggcggcggactggacatggtcgctgccgggccat
gtgccggagccgcgcgtgcccgccgacaacccgatgtcggcggtgaaggtcgagctgggc
cggcggctgttctacgatacccgcctgtccggcaacgggaccatcgcctgcgcctcctgc
cacatccaggcgaaggccttcaccgacggacgggcgctgtcgccgggatcgaccggcggg
ctgacccaccggaacgcccagccgctggcgaacagcgcctggaatgccacctacacctgg
gcgaacccggcgctggtgtcgctggagcggcagatggaggtcccgctgttcggcgacgac
cccgtcgagatgggggtgaccgacgccaaccgggcggcgatcctggagcggctgcgcgcc
gatcccgtttatccgccgctgttccgccagtcctttcccgacgaggcggagccgctgacc
atggcgacggtcatcaaggcgatcgcagccttccagcgcggcatcgtatcggtggacagc
cgctatgaccgctatctccagggcaaggccagcctgagcgaggcggagacgcggggcatg
gccctgttcttcggcgagcgggccgagtgccaccattgccatggcagcttcaatttcaac
gatcaggtcgtccacgcccggagccgggaggtggagacgccgttccacaacaccggcctc
tacaatctggacggcgccggggcctatcccttccccaaccgcggcctgttcgagttcacc
gccaagccggaggacatgggcgccttccgtgcgcccagcctgcgcaacgtggcggtgacc
ggcccctacatgcatgacggtggcatcgccacgctggcggcggtgatcgacgcctattcc
gatggcggccgggcggtgcgttcggggccgttgaagggcgacggccgcctcaacccgcac
aagagcggcctgatctcccgcatcgggctgacgccgcaggaaaagcgcgacctgctggcc
ttcctgggagcgctgacggacgagaccctgctgaccgacccgcgctggtcggatccctgg
aagaaatga

DBGET integrated database retrieval system