KEGG   Azospirillum sp. B510: AZL_009270Help
Entry
AZL_009270        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     AZL_009270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1051399..1052427
Genome map
AA seq 342 aa AA seqDB search
MATVGDFEFSSGLANKAMDRMRTDRLPPTPENFTLWYVYFSGNNPDLTRAIDLARRDGLA
ASQTLCEELYKRFFTMDAEAQAIRETSDKARYALGRILEQLGTVGSETERYGNALSGFRE
ELDQPLSLAELRAMVAAIAAETREIVDRQTALQLQLQESSHQLAEMRVSLDSARREALTD
ALTGIGNRKAFDQMLEEAMETSVRDEQPLSLLMVDIDHFKTFNDIHGHLVGDHVLKLVAR
MLTECIKGRDTATRYGGEEFAIILPRTSLENASKLAEQVRGFVGARQIVNKARNANYGTV
ALSVGVAQYRPGEPAMSLVRRADQALYAAKRGGRNRVTVEAV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggcgactgtgggggatttcgagttttccagcggtctcgccaacaaggccatggatcgg
atgcggaccgatcggcttccccccacccccgagaatttcacgctctggtacgtgtatttc
agcggcaacaatcccgacctgacccgcgccatcgatctggcgcgacgagacgggctggcc
gcctcgcaaaccctgtgcgaggagctgtataagcgcttcttcacgatggatgccgaagcc
caggcgatcagagagacgtccgacaaggcgcgttatgctctggggcgcatattggagcag
ctcggcactgtcggatcggagaccgagcgctatggcaacgccctgtccggcttccgggag
gagctggaccaaccgctcagcctggcggaattgcgcgccatggtcgccgccatcgcggcc
gagaccagggagatcgtcgaccgccagaccgccctgcaactccagcttcaggaatcgagc
catcagctggcggagatgcgggtcagcctggacagcgcccggcgcgaggcgctgaccgat
gcgctgaccgggatcggcaaccgcaaggccttcgaccagatgctggaggaggcgatggag
acgtcggtccgcgatgaacagccgctctcgttgctgatggtcgacatcgaccatttcaag
accttcaacgacatccacggccatctggtcggcgaccatgtgttgaagctggtggcgcgc
atgctgaccgaatgcatcaagggccgggacaccgcgacccgctatggcggcgaggagttc
gccatcatcctgccgcgcaccagcctggagaacgcctccaagctggccgagcaggtgcgc
ggcttcgtcggcgcccgccagatcgtcaacaaggcgcgcaacgccaattacggcaccgtc
gccctgtcggtcggcgtcgcccagtaccgtcccggtgaaccggcgatgtcgctggtccgc
cgggccgatcaggcgctctatgccgccaagcgcggtggccgcaaccgcgtcacggtcgag
gccgtctga

DBGET integrated database retrieval system