KEGG   Azospirillum sp. B510: AZL_009270Help
Entry
AZL_009270        CDS       T01169                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
azl  Azospirillum sp. B510
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1051399..1052427
Genome map
AA seq 342 aa AA seqDB search
MATVGDFEFSSGLANKAMDRMRTDRLPPTPENFTLWYVYFSGNNPDLTRAIDLARRDGLA
ASQTLCEELYKRFFTMDAEAQAIRETSDKARYALGRILEQLGTVGSETERYGNALSGFRE
ELDQPLSLAELRAMVAAIAAETREIVDRQTALQLQLQESSHQLAEMRVSLDSARREALTD
ALTGIGNRKAFDQMLEEAMETSVRDEQPLSLLMVDIDHFKTFNDIHGHLVGDHVLKLVAR
MLTECIKGRDTATRYGGEEFAIILPRTSLENASKLAEQVRGFVGARQIVNKARNANYGTV
ALSVGVAQYRPGEPAMSLVRRADQALYAAKRGGRNRVTVEAV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggcgactgtgggggatttcgagttttccagcggtctcgccaacaaggccatggatcgg
atgcggaccgatcggcttccccccacccccgagaatttcacgctctggtacgtgtatttc
agcggcaacaatcccgacctgacccgcgccatcgatctggcgcgacgagacgggctggcc
gcctcgcaaaccctgtgcgaggagctgtataagcgcttcttcacgatggatgccgaagcc
caggcgatcagagagacgtccgacaaggcgcgttatgctctggggcgcatattggagcag
ctcggcactgtcggatcggagaccgagcgctatggcaacgccctgtccggcttccgggag
gagctggaccaaccgctcagcctggcggaattgcgcgccatggtcgccgccatcgcggcc
gagaccagggagatcgtcgaccgccagaccgccctgcaactccagcttcaggaatcgagc
catcagctggcggagatgcgggtcagcctggacagcgcccggcgcgaggcgctgaccgat
gcgctgaccgggatcggcaaccgcaaggccttcgaccagatgctggaggaggcgatggag
acgtcggtccgcgatgaacagccgctctcgttgctgatggtcgacatcgaccatttcaag
accttcaacgacatccacggccatctggtcggcgaccatgtgttgaagctggtggcgcgc
atgctgaccgaatgcatcaagggccgggacaccgcgacccgctatggcggcgaggagttc
gccatcatcctgccgcgcaccagcctggagaacgcctccaagctggccgagcaggtgcgc
ggcttcgtcggcgcccgccagatcgtcaacaaggcgcgcaacgccaattacggcaccgtc
gccctgtcggtcggcgtcgcccagtaccgtcccggtgaaccggcgatgtcgctggtccgc
cgggccgatcaggcgctctatgccgccaagcgcggtggccgcaaccgcgtcacggtcgag
gccgtctga

DBGET integrated database retrieval system