KEGG   Azospirillum sp. B510: AZL_011360Help
Entry
AZL_011360        CDS       T01169                                 

Definition
two-component hybrid sensor and regulator, CheB glutamate methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZL_011360
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZL_011360
Enzymes [BR:azl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     AZL_011360
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZL_011360
Two-component system [BR:azl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AZL_011360
Bacterial motility proteins [BR:azl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZL_011360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1291266..1295882
Genome map
AA seq 1538 aa AA seqDB search
MQDPHDRDRATAARSGSAGGPARRHGRSPAALVAVGASAGGLKAITALLNGLPTDSRLAV
VVIQHRTPHNESLLIDLLSQSTALPIATAESGMVIEAGHIYIAPAGRILTLSQGAFAIAE
SPEGRVALPIDAFFSSLGIASQQNAICVVLSGTGADGSIGLKVVKECGGLVVAQDPTTAE
FDSMPCKAIATGLVDYVLAPDRMAEAIAAYVRQPYVGEIEENAFPPDSEALDHILGLMEA
QSHRDYRAYKTRTLMRRIERRMGIHQIGSLRDYSEFLGTHPAELEQLSRDILISVTRFFR
DPDAFALLDETVLTPMVRDREPGRPIRVWVPGCATGEEAYSIAMLLLEACAAANKSCDIK
VFGSDVDKHALEVARAGTYPETIAADVSPQRLSRFFTRVDGDYKVTRTLREAVSFALQNM
ISDPPFSNLDLISCRNVLIYIDPSVQQSILELFHFGLAEGGTLFLGSAEGVNSRGDLFTP
LSKKWRLFRKLGHGRRTGMALQTTVGARCGPVLASPVAARVSPAEITRQALLLAYAPAAV
LIDLQHRLLYLYGPTGDFLDLPTGELPQDLMAMMRGDLRIKVRAALEQAVASGQRVNVGG
IRQKRSGALVLVTVTVTPVSHPRTSERLLLVTFARGPGATAAPAAVTEPEELSEQADLSV
AEAMEHELRVTREELSATIQELEASNEALRAANEEILSVNEELQSSGEEMETSKEELQSL
NEELSTVNSQLQEKVDELEAITNDLTNLLTSTDIATLFLSPDLRVKRFTAPATRLFSLIP
TDIGRPITDVARHFADPALLDDLQAVLASLTPREREVETADGATLLRHVHPYRTQDNRIE
GTVITFSDVTPMKRVAATLSRRVRQQRLIADLGRRALEGEEPGLLLHSAAGLIADTFGAD
RVGIFGPSKDAKGLVLLEGTGWTQPDGVPREIPIDPSTLLGQVFWSKQPLIVGDFAADRR
TPGVPSSPEAGIASGVGVAFGGHEAKTTAVLALYSRQPWLFTDDDIEFVQAVANILGLAM
ERSAIQDAVRAARDFAEAIVDTVREPLLVLNHGLEVIAASQSFYRMFATSADATLGHRLS
EIAGAALHDETLSARLAEVAAQGTSLESLELIANPDGADPRSLLLYARPLNRSEHLILLG
IEDVTERNQSRQALAAAKAMAEQASAGKTRFLAAASHDLRQPVQAAVLFQHLLSTQDLPP
ASARVANSLGNTLTALQSMLDEILHISRLDAGVVNVNPKTFLLSTLLNQLVEEFSPLAGA
AGLKLKSVRTSLTVHSDPKLLSRILQNLLANAVKYTDAGRILIGCRRSADTVRIQVWDTG
RGIPEGQLAAIFEEFHQIGNLERDRRQGLGLGLSIVDRLATLLQHPIAVRSKPGSGSVFE
VAVPLAGDAARVEQPFSTTILNGGNRDILVIDDDPVVLDSLCQYLDQYGFKTTPASDRVE
ALERFSGQSPPRLIIADYRLRNDETGADVIRRLRKEFGAAVPGIILTGDTSPDRIREASR
SGFMLLHKPISPAEISLAISNALTDEDSRREITAPGLG
NT seq 4617 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacccccatgaccgcgaccgcgcaaccgccgcacgttccggttctgctgggggg
ccggcaaggcggcatggtcgcagcccggccgcattggtggcggttggggcctcggcaggc
ggactgaaggcgatcaccgcgctgctgaacggactgccgacggacagcaggctggccgtg
gtggtgatccagcaccggacacctcacaacgagtcgctgctgatcgacctgctgtcgcaa
agcaccgccctgccgatcgccaccgccgaatccggaatggtcatcgaggccgggcatatc
tacatcgctcccgcaggccgcatcctcaccctgagccagggcgccttcgccatcgcggag
tcgccggaagggcgggttgcgctgcccatcgacgccttcttcagttcccttggcatcgcc
agccaacagaatgccatctgtgtggtgttgtcgggaaccggggccgacgggtcgatcggc
ctgaaggtggtcaaggagtgcggtgggctggtggtggcccaggatccgaccaccgccgaa
ttcgacagcatgccgtgcaaggcgatcgcgaccggtttggtcgattacgtgctggcgccg
gaccgcatggccgaggcgatcgccgcctatgtccggcagccctatgtcggggagatcgaa
gagaacgccttcccgccggacagcgaggcgctcgaccatattctcggcctgatggaggct
cagagccatcgcgactaccgcgcctacaagacgcggacgctgatgcgccgcatcgagcgg
cgcatgggaatccaccagatcggcagtctgcgggactacagcgaattccttggaacccac
cccgccgaactggagcaactgtcccgcgacatcctgatcagcgtgacgcgcttcttccga
gatcccgacgcctttgcactgctcgacgaaacggtcctgacccccatggtgcgcgaccgg
gagccggggcgaccgatccgggtgtgggtcccgggctgcgccaccggcgaagaggcctat
tccatcgcgatgcttctgctggaggcctgcgcggcggcgaacaagagctgcgacatcaag
gtgttcggttccgacgtcgacaagcatgcgctggaggtcgcccgggcgggaacctatccg
gaaaccatcgcggccgatgtttcaccccagcggctttcccgattcttcaccagggtcgac
ggcgactacaaggtgaccaggacgctgcgggaagcggtttccttcgcgctccagaacatg
atcagcgatccgcccttctccaacctggatctgatcagttgccggaacgtcctgatctat
atcgatccgtcggtgcagcagtcgatcttggagctgttccatttcggactggcggagggc
ggcaccctgttcctggggtcggcggaaggcgtcaattcccgcggcgatctcttcacgccg
ctgtcaaagaaatggcggctgttccgcaagctcggccacggccgcagaaccgggatggcg
ttgcagaccacggtcggcgcccgatgcggtccggtcctggcgtcaccggtcgccgcccgg
gtcagcccggcggaaatcacccggcaggctctgttgctcgcctatgcgcctgccgcggtc
ctgatcgacctgcaacaccggctgctctacctctacggcccgaccggcgacttcctcgac
ctgccgaccggcgagttgccgcaggatctgatggcgatgatgcggggcgacctgcgcatc
aaggtgcgggccgccctggaacaggcggtggcgtcgggtcagcgggtgaacgtcggcggc
atccggcagaagcgctccggcgcgctcgtcctcgtcacggtcaccgtcacgccggtcagc
cacccgcgcacatcggagcggttattgctggtcaccttcgcccgcggaccgggtgcgacc
gccgcgccggctgccgtgacggagccggaagagctgtccgaacaggccgatctgtcggtt
gccgaggccatggaacatgagctgagggtaacgcgcgaggagctgagcgccaccatccag
gagttggaggcatcgaacgaggccctgcgcgcagccaacgaggaaatcctatcggtcaac
gaggagcttcagtcgtccggcgaggagatggagacctccaaggaggaactgcagtccctg
aacgaggagctgagcaccgtcaacagccagcttcaggagaaggtcgacgagttggaagcc
atcaccaacgacctgaccaatctgctgaccagcaccgacatcgccaccctgttcctgtcg
ccggacctgcgggtcaagcggttcaccgccccggccacccgcctgttctccctgatcccg
acagatatcgggcggccgatcaccgacgtcgcccgtcacttcgccgatcccgcgctgctg
gacgacctgcaggcggtcctggcctcgctgaccccgcgggaacgcgaggtggaaaccgcg
gacggggcgacactgctgcgtcatgtccatccctaccggacccaggacaaccggatcgaa
gggacggtcatcaccttcagcgacgtcacgccgatgaaacgggtcgccgcgacgctgagc
cggcgggtgcgtcagcaacggctgatcgccgatctgggccgccgggcactggagggcgag
gagcccggccttctgctgcattccgccgccggcctgatcgcggacaccttcggcgccgat
cgcgtcggcatcttcggcccttccaaggacgccaaggggctggtgttgcttgagggaacc
ggctggacccagcccgacggcgtcccgcgggaaatcccgatcgatccgtcgacgctgctc
ggtcaggtgttctggtcgaagcagccgctgatcgtcggagatttcgccgccgaccggcgg
acccccggcgttccgtcctcccccgaagccgggatcgccagcggcgtcggcgtcgccttc
ggcggtcacgaggcgaagacgaccgccgtcctggccctttacagccgccagccctggctg
ttcaccgacgacgacatcgaattcgtccaggccgtcgccaacatccttggtctggcgatg
gaacgcagcgccatacaggatgcggtccgggcggcgcgggacttcgccgaggcgatcgtc
gataccgtgcgcgagcctctgctggttctgaaccacggtctggaggtgatcgcggccagc
cagtccttctaccgcatgttcgcgacctcggccgacgcaaccctcggtcatcggctgagc
gaaattgcaggtgccgccctccacgacgagacgctgagtgcccgcctcgcggaggtcgcg
gcacagggaacctcgctggaatcgctggaactgatcgccaatcccgatggggccgacccg
cgctcgctgctgctctacgcccgcccgctcaaccgatccgaacacctgatcctgctcggg
atcgaggacgtcacggaacgcaatcagtcgcggcaggcgcttgccgcggccaaggcgatg
gcggagcaggcgagtgccgggaaaacccgcttccttgccgccgccagccacgacctgcgc
cagccggtgcaggccgcggtcctgttccagcacctgctgtccacgcaggatctgccgccg
gcgagcgcgcgggtcgccaatagcctgggaaacaccctgaccgccctccagagcatgctg
gacgaaatcctgcatatatcccggctggacgccggggtggtcaatgtcaacccgaagacc
tttctgctcagtacgcttctgaaccagctggtggaggagttctcgccgctggccggtgcc
gccgggctgaaactgaagtcggtccgaaccagccttacggttcacagcgatcccaagctg
ctgagccggatcttgcagaacctactggccaatgccgtcaagtacaccgatgccgggcgc
atcctgatcgggtgccggcggtcggcggacaccgtccgcatccaggtctgggacaccggc
cgggggattcccgagggtcaactcgctgcgatcttcgaggaattccaccagatcggcaat
ctcgagcgggatcgccggcaggggcttggcctcgggttgtcgatcgtagaccgcttggcg
acactgctccaacatccgatcgctgtacgctcgaagcccggcagcggatcggtgttcgag
gtcgccgttcccctcgccggggacgcggcacgggtggaacagcccttttccaccaccatc
ctgaatggcgggaaccgggacatcctggtgatcgacgacgatccggtggtgctggacagc
ctgtgtcaatatctcgatcaatacggtttcaagacgacgccggcctcggaccgcgtcgag
gcgttggaacggttttccggacaatcgcccccacgcctgatcatcgccgactaccggctg
cgcaacgacgagacaggcgccgacgtcatcaggcgcctgcggaaggaattcggggcggcg
gtgccggggattatcctcaccggggacacctcgccggatcggatccgggaagccagccga
agcggcttcatgctgttgcacaagccgatctctccggccgagatatccctggcgatcagc
aatgcgttgaccgacgaagacagccggcgagagatcaccgcaccgggactcgggtga

DBGET integrated database retrieval system