KEGG   Azospirillum sp. B510: AZL_013040Help
Entry
AZL_013040        CDS       T01169                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AZL_013040 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1492616..1493272
Genome map
AA seq 218 aa AA seqDB search
MTDFAAARYFMVEGQIRPNKVTDHRLVDVLSELPREAFVPESARGVAYVDDDLPIGKGRF
LLEPMVFARMLQAVAVQETDRVLDVGAAGGYSTAVLARLASSVVGLDCDDALTAAASAAL
AGQGIANAKTVTGPLAEGYAQNAPYDVIVVEGTVPEVPASLTGQLAEGGRLVAIVQGTGG
VGEVRLFQRVAGVVSSRILFEARPHALPGFEKKASFVF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcgccgccgcacgctatttcatggtcgagggacagatccgtcccaacaag
gtgaccgatcaccgtctcgtcgacgtcctgtcggagcttccgcgcgaagccttcgtccca
gaatcggcgcgcggcgtcgcttatgtcgatgacgatctccccatcggcaagggccgcttc
ctgctggagccgatggtcttcgcccgcatgctccaggccgtcgccgtgcaggagaccgac
cgtgttctcgacgtcggtgccgccggtggctactccaccgctgtgctggcccgtctggcg
tcgtcggtggtcgggctcgattgcgacgacgcgctgaccgccgccgcctcggcggcgctg
gcagggcaggggatcgccaatgccaagaccgtcaccggtccgctggcggaggggtacgcc
caaaacgccccttacgacgtcatcgtcgtcgagggtaccgtgccggaggttccggcgtcg
ctgaccggccaactggcggaaggcgggcgtctggtcgccatcgtccagggcacgggcggc
gtcggcgaggtccgcctgttccagcgcgtcgccggcgtggtgtccagccgcatcctgttc
gaggcccggccgcacgcgctgcctggcttcgaaaagaaggcgtccttcgtgttctga

DBGET integrated database retrieval system