KEGG   Azospirillum sp. B510: AZL_013680Help
Entry
AZL_013680        CDS       T01169                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
azl  Azospirillum sp. B510
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZL_013680 (tpiA)
   01230 Biosynthesis of amino acids
    AZL_013680 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_013680 (tpiA)
   00051 Fructose and mannose metabolism
    AZL_013680 (tpiA)
   00562 Inositol phosphate metabolism
    AZL_013680 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZL_013680 (tpiA)
Enzymes [BR:azl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AZL_013680 (tpiA)
Exosome [BR:azl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AZL_013680 (tpiA)
  Exosomal proteins of bladder cancer cells
   AZL_013680 (tpiA)
  Exosomal proteins of melanoma cells
   AZL_013680 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1568761..1569516
Genome map
AA seq 251 aa AA seqDB search
MTANRKLIAGNWKMNGLKADGLDLASDLAGRLKGAGPVAFDMLVCPPFQLLFPVGEAITD
SPLALGGQDCAPRNSGAHTGDIAPAMLKDAGCRFVILGHSERRADHGESDAVVNAKAAAA
LKEGLVAIICVGETEAQRDAGQANAVVSGQLAGSIPAGATAENTVIAYEPVWAIGTGKTA
TPDDVKAMHAHIRAELTGRIADPAKARILYGGSVKPGNAAELMAVENVDGALVGGASLKA
DDFWAIATACR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaaccggaagctgatcgccggaaactggaagatgaacgggttgaaggccgat
gggctggatctcgcctccgacctcgccgggcggctgaagggtgccggcccggtcgcgttc
gacatgctggtctgcccgcccttccagctgctgtttccggtgggggaggcgatcaccgac
agcccgctggcgctgggtggtcaggactgcgcgccgaggaattccggcgcccacaccggc
gacatcgccccggccatgctgaaggacgccggatgccgattcgtcatcctcggccattcg
gagcgtcgcgccgaccatggcgagagtgacgccgtcgtcaacgccaaggccgccgccgcg
ctgaaggaaggtctggtcgccatcatctgcgtcggcgagaccgaggcgcagcgcgacgcc
ggccaggcgaacgccgtggtgtccggccagctcgccggttcgattcccgccggcgccacg
gcggagaacaccgtcatcgcctatgagccggtctgggccatcggtaccggcaagaccgcg
actccggacgacgtcaaggcgatgcacgcccatatccgggccgagctgaccggcaggatc
gccgacccggccaaggcccgcatcctctatggcggttcggtcaagccgggcaacgcggcg
gaactgatggcggtggagaatgtcgatggcgcgctggtcggcggtgcctcgctgaaggcc
gacgatttctgggccatcgccaccgcctgccgctga

DBGET integrated database retrieval system