KEGG   Azospirillum sp. B510: AZL_014060Help
Entry
AZL_014060        CDS       T01169                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
azl  Azospirillum sp. B510
Pathway
azl00071  Fatty acid degradation
azl00280  Valine, leucine and isoleucine degradation
azl00281  Geraniol degradation
azl00310  Lysine degradation
azl00360  Phenylalanine metabolism
azl00362  Benzoate degradation
azl00380  Tryptophan metabolism
azl00410  beta-Alanine metabolism
azl00627  Aminobenzoate degradation
azl00640  Propanoate metabolism
azl00650  Butanoate metabolism
azl00903  Limonene and pinene degradation
azl00930  Caprolactam degradation
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01130  Biosynthesis of antibiotics
azl01212  Fatty acid metabolism
Module
azl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AZL_014060
   00650 Butanoate metabolism
    AZL_014060
  Lipid metabolism
   00071 Fatty acid degradation
    AZL_014060
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZL_014060
   00310 Lysine degradation
    AZL_014060
   00360 Phenylalanine metabolism
    AZL_014060
   00380 Tryptophan metabolism
    AZL_014060
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZL_014060
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AZL_014060
   00281 Geraniol degradation
    AZL_014060
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZL_014060
   00627 Aminobenzoate degradation
    AZL_014060
   00930 Caprolactam degradation
    AZL_014060
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AZL_014060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: BAI72044
RhizoBase: AZL014060
UniProt: D3NUG5
Position
1613014..1614075
Genome map
AA seq 353 aa AA seqDB search
MSDDAEILFERRGAIGLVTLNRPKALNALTLGMIRLFDPQLRAWDADPEVKAVVIRGAGE
KAFCAGGDVVSLYEAGKAAKEGRGDTSPIRAFFSEEYVLNRLIKRLSKPYVAVIDGISMG
GGVGLSVHGSHRIVTERTLFAMPETGIGLYPDVGGTYFLPRLPGQVGVWLGLTGDRLKAA
DLLAIGAADAFVPSGEIDGLIGDLAAGRPADEAIATRRGDAGEAMVRALRAVIDRCYAFD
SVEAIVKALEAEGGDWANGQLATLRRVSPTSLKVTLAALRRGAGLDFDGCMVQELRLSLA
CLAGVDFYEGIRAVLVDKDKSPKWKPANLADVGPSDVARHFTEPAGGDLLFRD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgatgctgagattctgttcgaacgtcggggtgccatcggcctcgtcacgctg
aaccggccgaaggcgctgaacgccttgacgctcggcatgatcaggctgttcgatccgcag
ctgcgggcctgggatgccgatccggaggtcaaggccgtcgtgattcgcggtgccggcgaa
aaggccttctgcgccggcggcgatgtggtcagcctctatgaagccggaaaggcggcgaag
gaggggcgtggcgacaccagcccgattcgcgccttcttcagcgaggaatatgtgttgaac
cggctgatcaagcggttgtccaagccctatgtcgcggtgatcgacggtatttccatgggc
ggcggcgtcggcctgtcggtccatggcagccaccgcatcgtcaccgaacgcacgctgttc
gccatgccggaaaccggcatcggcctttatcccgatgtcggcggcacttatttcctgccg
cgcctgccggggcaggttggcgtctggctggggctgaccggtgatcggctcaaggccgcc
gacctgttggccatcggcgccgccgacgccttcgtgccgagcggggagatcgatgggctg
atcggcgatctcgccgccgggcggccggcggacgaggcgatcgccacccgccgcggcgat
gccggcgaggcgatggtgcgtgcgttgcgggcggtgatcgaccgctgttatgccttcgac
agcgtcgaggcgatcgtcaaggcgttggaagccgagggcggcgactgggcgaacggccaa
ctcgccacgctgcgccgggtgtcgccgaccagcctgaaggtgacgctggcggcgcttcgg
cgcggtgccgggctggatttcgacggctgcatggtgcaggagctgcgcctcagcctcgct
tgtcttgccggggttgatttctacgagggcatccgcgccgttctggtggacaaggacaaa
tccccgaaatggaaaccggcgaatcttgccgatgtcggcccgtcggacgtcgcgcgtcac
ttcaccgaaccggcggggggcgaccttctgttccgcgactga

DBGET integrated database retrieval system