KEGG   Azospirillum sp. B510: AZL_015350Help
Entry
AZL_015350        CDS       T01169                                 

Gene name
cysQ
Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
azl  Azospirillum sp. B510
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:azl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1767550..1768326
Genome map
AA seq 258 aa AA seqDB search
MPDAAVASLLPTVRTIAHEAGQVILRFYNDGIDVATKVDGSPVTQADQAAEAVIVPALHH
LLPGVPVVAEEAMAAGHKPDISGGRFWLVDPLDGTKEFISRNGEFTVNIALIEGGVPVLG
VVYAPATGDLYAAAGPGTAVHCAEGRHDHAIAVRTPPADGLTVVASRSHGSGSALEDFLG
KFAVKDRVSCGSSLKFCTVASGKADLYPRLGPTSEWDTAAGHAVLIGAGGRVEQPDGSPL
VYGKDDILNPHFVAYGWK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgccgctgtggcgagcctgctgccgacggtccgcaccatcgcccatgaggcc
ggtcaggtcatcctgcgcttttacaacgacggcatcgacgtcgccaccaaggtcgacggc
agcccggtgacgcaggcggatcaggcggcggaggcggtaatcgtcccggcgctccaccat
ctgctccccggtgtgccggtggtcgcggaagaggcgatggccgccggccacaagcccgac
atttccggcggccgcttctggctggtcgatccgctcgacggcaccaaggagttcatctcc
cgcaacggcgagttcacggtgaacatcgccctgatcgagggtggcgtccccgtgctgggc
gtcgtctatgccccggccaccggcgacctctatgcggcggcggggcccggcaccgccgtc
cattgcgcggaggggcggcacgatcacgccatcgccgtccgcaccccgccggccgacggc
ctgaccgtggtcgccagccggtcgcatggcagcggctcggccctggaggacttcctcggc
aaattcgccgtcaaggaccgggtgtcctgcggcagctcgctgaaattctgcacggtggct
agcggcaaggccgacctctatccccgcctggggccgaccagcgaatgggacaccgccgcc
ggccatgccgtgctgatcggcgccggcggccgggtggaacagccggacggctcgccgctg
gtctatggcaaggacgacatcctgaacccccatttcgtcgcctacggctggaaatga

DBGET integrated database retrieval system