KEGG   Azospirillum sp. B510: AZL_016020Help
Entry
AZL_016020        CDS       T01169                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
azl  Azospirillum sp. B510
Pathway
azl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01130  Biosynthesis of antibiotics
azl01230  Biosynthesis of amino acids
Module
azl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZL_016020 (trpC)
Enzymes [BR:azl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AZL_016020 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-ProteinID: BAI72240
RhizoBase: AZL016020
UniProt: D3NV11
Position
1833121..1833924
Genome map
AA seq 267 aa AA seqDB search
MSDVLTRINDDKRALVAARKAARPLSEVEAAAKAANETNPPRGFIRALSAAVEAGRYGLI
AEIKKASPSKGLIRADFDPPSLARAYREGGATCLSVLTDEPYFQGRDEYLVAARAAVDLP
VLRKDFMVDPYQIVEARALGADCILIIMASLSDAQAAEIEDAAIAQGLDVLVEVHDRAEL
DRALALRTPLLGVNNRNLKTLTVDIATTEELAANVPADRMLVAESGLHTPADLARMAKVG
ARCFLVGESLMRQADVTAATRALLAPV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgttctgacccgcatcaacgacgacaagcgcgccctggtggcggcccgcaag
gccgcccgcccgctgtcggaggtcgaggccgcggccaaggccgccaacgagaccaatccg
ccgcgcggcttcatccgggcgctcagcgccgcggtggaggccggccgctacggcctgatc
gccgagatcaagaaggcgagcccgtccaagggcctgatccgcgccgacttcgacccgccg
tcgctcgcccgcgcctaccgggaggggggagcgacctgcctgtcggtgctgaccgacgag
ccctatttccagggccgggacgagtatctggtggccgcccgcgccgcggtcgatctgccg
gtgctgcgcaaggacttcatggtcgatccctatcagatcgtggaggcccgcgcgctgggc
gccgactgcatcctgatcatcatggcctcgctgtccgacgcccaggcggcggagatcgag
gatgccgcgatcgcccagggactggacgtgctggtcgaggtgcatgaccgcgccgagctg
gaccgcgcgctggcgctgaggacgccgctgctcggcgtcaacaaccgcaacctcaagacg
ctcaccgtcgacatcgcgacgacggaggagctggcggccaatgtgccggccgaccgcatg
ctggtcgccgaaagcgggctccacacccccgccgatctggcacggatggcgaaggtcgga
gcccgctgcttcctggtcggcgaatcgctgatgcggcaggccgacgtcaccgccgccacc
cgcgccctgctcgccccggtctga

DBGET integrated database retrieval system