KEGG   Azospirillum sp. B510: AZL_017430Help
Entry
AZL_017430        CDS       T01169                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
azl  Azospirillum sp. B510
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:azl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:azl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:azl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:azl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:azl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:azl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:azl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1983692..1984786)
Genome map
AA seq 364 aa AA seqDB search
MTAPKKAGKRIGILTSGGDCAGLNAVIRAVVHRATGYGWQVLGIKEGTQGLLQRPVQYQT
LDLGSVDGHMMRQGGTILGTTNRGDPFAYPMPDGTLKDRSDEIVGGYRELGLDALIGIGG
DGSFAILHKLAQKGGFPMVGVPKTIDNDLGKTEVSVGYDTAVAVAVEALDRLQPTAASHH
RVMVLEVMGRDAGHIALAAGIAGGADVILIPEIPYSIESIAAKIQEVRESGRNFALVVVS
EAVKTLEGTGVKKVLQGGEKRYGGIGDYIGEKIADATGAETRVTVLGHVQRGSMPSPRDR
LIASAFGVHAVDLIAEGRFNRMVAWSNRGVIDVPITEAIEHYSCVELDGALVKTARGLNI
SFGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccccaagaaagccggcaagcgcatcggcatcctgaccagcggcggcgactgc
gccgggctgaacgcggtgatccgcgcggtggtccaccgcgccaccggctatggctggcag
gtgctgggcatcaaggaaggcacccagggactgctccagcgcccggtccagtatcagacg
ctcgatctcggctccgtcgacggccacatgatgcgccagggcggcaccatcctgggcacc
accaaccgtggcgaccccttcgcctacccgatgcccgacggcacgctgaaggaccgctcc
gacgagatcgtcggcggctaccgcgaactcggcctcgacgcgctgatcggcatcggcggc
gacggcagcttcgccatcctgcacaagctggcgcagaagggcggctttccgatggtaggc
gtgcccaagaccatcgacaatgatctgggcaagaccgaggtgtcggtcggctacgacacc
gccgtcgccgtcgcggtcgaggcgctcgaccgcctgcaaccaaccgccgccagccatcac
cgcgtgatggtgctggaggtgatgggccgcgacgccggccacatcgcgctggcggccggc
atcgccggcggcgccgacgtgatcctgatccccgagatcccctattccatcgaaagcatc
gccgccaagattcaggaggtccgcgagtccggccgcaacttcgccctggtcgtggtgtcg
gaggcggtgaagaccctggagggcaccggcgtcaagaaggtgcttcagggcggcgagaag
cgctatggcggcatcggtgattacatcggcgagaagatcgccgacgccaccggggccgag
acccgcgtcaccgtgctgggccatgtccagcgcggcagcatgcccagcccgcgcgaccgg
ctgatcgcctcggccttcggcgtccatgccgtcgacctgatcgcggagggcaggttcaac
cgcatggtcgcctggtccaaccgcggcgtcatcgacgtgccgatcaccgaggcgatcgag
cattattcctgcgtcgagctggacggggcgctagtgaagacggcccgcggcctgaacatc
agctttggcgattga

DBGET integrated database retrieval system