KEGG   Azospirillum sp. B510: AZL_023290Help
Entry
AZL_023290        CDS       T01169                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
azl  Azospirillum sp. B510
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZL_023290 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZL_023290 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AZL_023290 (proB)
Enzymes [BR:azl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AZL_023290 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2648024..2649163
Genome map
AA seq 379 aa AA seqDB search
MALDAPTLLESRRLVVKIGSALLVDGETRQIRRDWLDALADDVAACRKRGQEVVIVTSGA
VACGREHLGLVGRALKLEEKQAAAATGQIRLAHAYQETLARHDVTVAQVLVTLEDTEERR
RHLNARNTIDTLLKLGAVPVINENDTVATAEIRFGDNDRLAARVAQMVSADTLVLLSDID
GLYTADPRKAPDARHIPTVRELTPEIEGMAGEPPPGYSSGGMVTKIAAARVALSAGCRMV
IAKGKRMNPLTALEKRPEDGGALCTWFLPSAEPTSARKAWIAGHVNAAGVLVVDDGAMRA
LSHGASLLPAGVAAVQGEFDRGDVVIVRTQEGREVARGLVAYSADDARKILRHKSTEIPE
ILGYQGRDEMIHRDDLVVR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgacgcccccacccttctcgaatcccgccggctggtcgtgaagatcggctcg
gctcttctggtcgacggggaaacccggcaaatccgccgggactggctcgacgcgctggcc
gatgacgtcgccgcctgccgcaagcgcgggcaggaggtggtcatcgtcacctccggcgcc
gtcgcctgcggacgcgagcatcttggtctcgtcggccgggcgctgaagctggaggagaag
caggcggccgccgccaccggccagatccgcctcgcccacgcctatcaggagaccctggcc
cgccacgacgtcaccgtcgcccaggtgctggtgacgctggaggacaccgaggagcggcgg
cgccacctcaacgcccgcaacaccatcgacacgctgctgaagctgggtgccgttcccgtc
atcaacgagaacgacacggtcgccaccgcggaaatccgcttcggcgacaatgaccggctc
gccgcccgcgtggcgcagatggtcagcgccgacacgctggtcctgctgtcggacatcgac
ggcctctacaccgccgacccgcgcaaggccccggacgcccgccacatccccacggtgcgc
gaactgacgccggagatcgagggcatggccggcgagccgccccccggctacagcagcggc
ggcatggtgaccaagatcgccgccgcccgcgtcgccctgtcagccggctgccgcatggtc
atcgccaagggcaagcgcatgaacccgctgacggcgctggagaagcggccggaggatggc
ggcgctctctgcacctggttcctgccctcggccgagccgaccagcgcccgcaaggcctgg
atcgccggccatgtcaacgccgccggcgtgctggtggtcgatgacggcgccatgcgcgcc
ctgtcccatggcgccagcctgctgccggccggcgtcgccgccgtgcagggcgagttcgac
cgcggcgacgtggtgatcgtccgcacccaggaggggcgcgaggtcgcgcgcggcctcgtc
gcctacagcgccgacgacgcccgcaagatcctgcgccacaagagcacggagatcccggag
atcctgggctatcaggggcgcgacgagatgatccaccgcgacgatctggtggtgcgatga

DBGET integrated database retrieval system