KEGG   Azospirillum sp. B510: AZL_025140Help
Entry
AZL_025140        CDS       T01169                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
azl  Azospirillum sp. B510
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:azl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AZL_025140 (recR)
DNA repair and recombination proteins [BR:azl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AZL_025140 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2866261..2866854
Genome map
AA seq 197 aa AA seqDB search
MIGPEIERLIQLLSKLPGLGPRSARRAALHLMKRRDSLLVPLSEAMAAAGESIRACSVCG
NLDSRDPCTVCADPARDRSVICVVEDAGDLWALERTRAFRGTYHVLGGLLSALQGVGPDD
LNLAGLAERAKDPAVREIILALNATVDGQTTAHVVTDRLTDSDVSVSRLAHGVPVGGELD
YLDDGTLTAALKARRPL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacctgaaatcgaacgcctgatccagttgctgtccaaactgccggggctcggc
ccccggtcggcgcggcgggcggctcttcatctgatgaagcgccgcgacagcttgctggtt
cccctgtcggaagcgatggcggcggccggcgaatcgatccgcgcctgctccgtctgcggc
aatctggacagccgcgatccctgcaccgtctgtgccgaccccgcccgcgaccgctcggtc
atctgcgtggtcgaggatgccggcgatctgtgggcgctggaacgcacccgcgccttccgc
ggcacctatcatgtgctgggcgggctgctgtcggccttgcagggcgtcggccccgacgat
ttgaaccttgccggccttgccgagcgcgccaaggatccggcggtgcgcgagatcatcctg
gcgctgaacgccaccgtcgacggccagaccaccgcccatgtggtgaccgaccgcctgacc
gactccgacgtctcggtctcccgcctcgcccatggcgttccggtcggcggcgagctggac
tatctcgacgatggcacgctcaccgcggcgctgaaggcaagacggccgctgtag

DBGET integrated database retrieval system