KEGG   Azospirillum sp. B510: AZL_025790Help
Entry
AZL_025790        CDS       T01169                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZL_025790 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZL_025790 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AZL_025790 (sucB)
Enzymes [BR:azl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AZL_025790 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2946322..2947563
Genome map
AA seq 413 aa AA seqDB search
MATDIKVPTLGESVSEATVARWLKKAGEAVAMDEALVELETDKVTLEVNASAAGVLAEIV
APEGANVEVGALLGVIAEGASAGAVPAAPAPAAAPAAAAPAPAAAPAAPGNIAASGPAAR
KLADEKGVDTSAIAGSGKDGRITKGDVLAAPAAAPAAKPAAPAPAPKVQWAAGTQGDRPR
AAQEERVRMTRLRQRIAERLKEAQNSAAMLTTFNEVDMSAAIALRAEYKDYFEKRHKVRL
GFMSFFVKAAVQALKEIPAVNAEIDGTDIVYKNYYDIGVAVGTPQGLVVPVVRDADKLDF
AGVEGTIAALGKKGRDGKLSMDELTGGTFTISNGGVYGSLMSTPIINPPQSAILGMHKTM
DRAVVVGGKIEVRPMMYLALSYDHRIIDGKEAVTFLVRIKELIEDPRRLLLDV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgacatcaaggtccccacgctgggtgagtccgtctccgaagcgacggtcgcc
cgctggctgaagaaggccggcgaggccgtcgccatggacgaggcgctggtcgagctggag
accgacaaggtcacgctggaggtgaacgcctcggccgccggcgtgctggccgagatcgtc
gctccggaaggggccaacgtcgaggtcggcgccctgctgggcgtcatcgctgaaggcgcc
agcgccggtgccgtgccggcggcccccgctcccgccgccgccccggcggcggcggctccg
gccccggccgccgcgcccgccgcgcccggcaacatcgccgcctccggcccggccgcccgc
aagctggccgacgagaagggcgtcgacacgtccgccatcgccggttcgggcaaggatggc
cgcatcaccaagggcgacgtcctcgccgccccggccgccgctcccgccgccaagccggcc
gctccggccccggcgccgaaggtccagtgggccgccggcacccagggcgaccgtccccgc
gccgcgcaggaggagcgcgtccgcatgacccgcctgcgccagcgcatcgccgagcgtctg
aaggaggcgcagaacagcgccgccatgctgaccaccttcaacgaggtggacatgtcggcg
gcgatcgcgctgcgcgccgagtacaaggactatttcgagaagcgccacaaggtgcggctc
ggcttcatgtccttcttcgtcaaggccgccgtccaggcgctgaaggagatcccggcggtc
aacgccgagatcgacggcaccgacatcgtctacaagaactactatgacatcggcgtcgcc
gtcggcacgccgcagggtctggtcgttccggtcgtccgcgacgccgacaagctcgatttc
gccggcgtggaaggcaccatcgccgcgctcggcaagaagggccgcgacggcaagctgtcg
atggacgagctgacggggggcaccttcaccatctccaacggtggtgtctacggctcgctg
atgtcgaccccgatcatcaacccgccgcagtcggccatcctcggcatgcacaagacgatg
gaccgcgcggtcgtcgtcggcggcaagatcgaggtccgcccgatgatgtatctggcgctg
tcctacgatcaccgcatcatcgacggcaaggaggcggtcaccttcctcgtccgcatcaag
gagctgatcgaggacccgcgccgcctgttgctggacgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system