KEGG   Azospirillum sp. B510: AZL_027070Help
Entry
AZL_027070        CDS       T01169                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
azl  Azospirillum sp. B510
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZL_027070 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZL_027070 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZL_027070 (trpA)
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZL_027070 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(3097550..3098410)
Genome map
AA seq 286 aa AA seqDB search
MSAAVKSADILADGRIARRFNALKAEGRAGLVSFITAGDPDPATSQAVLNGLPAAGADLI
ELGMPFTDPMADGPAIQASSLRALKAGMTVRKTLDMVRGFRERDADTPIILMGYFNPIHA
YGVEPFLAAAREAGVDGLIVVDLPPEEDEELCLPAVAAGVSFVRLTTPTTDEARMPAVMR
NTSGFVYYVSIAGITGTASASNTAIDAAVARLKRHTNLPVAVGFGIKTPDQAAEVARVAD
AAVVGSAIVTRLADGIDASGAVKPGTVEDVLGFVGELAEGVRAARG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccgccgtgaagagtgccgacatcttggccgatggccgcatcgcccgccggttc
aatgcgctgaaggcggagggacgcgccggtctggtcagcttcatcaccgccggcgatccc
gatcccgccacctcgcaggcggtgctgaacggcctgccggccgccggcgccgacctgatc
gagctcggcatgcccttcaccgatccgatggccgacggcccggcgatccaggcctcctcg
ctgcgggcgctgaaggccggcatgacggtgcgcaagacgctggacatggtccgcggcttc
cgtgagcgggatgccgacacgccgatcatcctgatgggctatttcaacccgatccacgcc
tatggggtggagcccttcctggccgccgcgcgcgaggccggggtcgacgggctgatcgtc
gtcgacctgccgccggaagaggacgaggagctgtgccttccggcggtcgcggccggcgtc
agcttcgtgcgcctgaccacgccgaccaccgacgaggcgcgcatgccggccgtgatgcgc
aacacctcgggcttcgtctattacgtgtcgatcgccggcatcaccggcaccgccagcgcg
tccaacaccgccatcgacgcggcggtcgcccggctgaagcgtcataccaacctgccggtc
gccgtcggcttcggcatcaagacgccggaccaggccgccgaggtcgcccgcgtcgccgac
gccgccgtcgtcggctccgccatcgtcactcgtctggccgatgggatcgacgcgtccggc
gcggtcaagccgggcacggtcgaggatgtgctcggcttcgtcggcgaactggccgagggt
gtgcgcgcggcgcggggctga

DBGET integrated database retrieval system