KEGG   Azospirillum sp. B510: AZL_027080Help
Entry
AZL_027080        CDS       T01169                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
azl  Azospirillum sp. B510
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:azl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:azl00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:azl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3098407..3099624)
Genome map
AA seq 405 aa AA seqDB search
MSKLNTYRSGPDERGHFGIFGGRFVAETLMPLILEVEKAYREARADPAFEGEMRQQLKQY
VGRPNPLYYAERLTEQLGGAKIYFKREELNHTGAHKINNCIGQILLARRMGKTRIIAETG
AGQHGVATATVCALYDMPCVIYMGETDIARQQPNVFRMKLLGAEVRPVTSGSGTLKDAMN
EALRDWVTNVADTFYIIGTAAGPHPYPAMVRDFQSVIGDEVRTQMQELEGRLPDSLVACV
GGGSNAIGLFHPFLDDPSVQMIGVEAAGRGIEKGPLDHAASINGGRPGVLHGNRTYLLQD
EDGQILEGHSISAGLDYPGIGPEHSWLHDVGRVEYAYATDQEALDAFQLCARTEGIIPAL
ESAHGLAEVIKRAPKLPKDHLMVLCLSGRGDKDIFSVAKHLGVEL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaactgaacacctaccgctccggtcccgacgagcgcgggcatttcggaatcttt
ggcggccgcttcgtcgccgagacgctgatgcccctgatcctggaggtcgagaaggcctat
cgcgaggcgcgcgccgatcccgccttcgaaggggagatgcgccagcagctgaagcaatat
gtcggccgccccaacccgctctattacgcggaacgcctgaccgagcagctgggcggcgcc
aagatctacttcaagcgcgaggagctgaaccacaccggcgcgcacaagatcaacaactgc
atcggccagatcctgctggcgcggcgcatgggcaagacccgcatcatcgccgagacgggc
gccggccagcatggcgtggcgaccgcgacggtctgcgcgctctatgacatgccctgcgtc
atctacatgggcgagaccgacatcgcccgccagcagcccaacgtcttccgcatgaagctg
ctgggcgccgaggtccgcccggtgacgtcgggcagcggcacgctgaaggacgcgatgaac
gaggcgctgcgcgactgggtcaccaacgtcgccgacaccttctacatcatcggcaccgcc
gccggcccgcacccttatcccgccatggtccgcgacttccagtcggtgatcggcgacgag
gtgcggacccagatgcaggagctggagggccgcctgcccgacagcctggtcgcctgtgtc
ggcggcggctccaacgccatcggcctgttccatcccttcctcgacgacccgtcggtgcag
atgatcggcgtcgaggccgccggccgcggcatcgagaaggggccgctcgaccatgccgcc
tcgatcaacggcggccgtcccggcgtgctgcacggcaaccgcacctatctgctgcaggac
gaggacggccagatcctggagggccactcgatctccgccggcctcgactatcccggcatc
gggccggagcatagctggctgcacgatgtcggccgcgtcgaatacgcctatgccaccgac
caggaggcgttggacgccttccagctctgcgcccgcaccgagggcatcatcccggcgctg
gaatccgcccacggccttgccgaggtgatcaagcgcgcgccgaaactgcccaaggaccac
ctgatggtgctgtgcctgtcgggccgcggcgacaaggacatcttctccgtcgccaagcat
ctgggagtggaactgtga

DBGET integrated database retrieval system