KEGG   Azospirillum sp. B510: AZL_027080Help
Entry
AZL_027080        CDS       T01169                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
azl  Azospirillum sp. B510
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZL_027080 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZL_027080 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZL_027080 (trpB)
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZL_027080 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(3098407..3099624)
Genome map
AA seq 405 aa AA seqDB search
MSKLNTYRSGPDERGHFGIFGGRFVAETLMPLILEVEKAYREARADPAFEGEMRQQLKQY
VGRPNPLYYAERLTEQLGGAKIYFKREELNHTGAHKINNCIGQILLARRMGKTRIIAETG
AGQHGVATATVCALYDMPCVIYMGETDIARQQPNVFRMKLLGAEVRPVTSGSGTLKDAMN
EALRDWVTNVADTFYIIGTAAGPHPYPAMVRDFQSVIGDEVRTQMQELEGRLPDSLVACV
GGGSNAIGLFHPFLDDPSVQMIGVEAAGRGIEKGPLDHAASINGGRPGVLHGNRTYLLQD
EDGQILEGHSISAGLDYPGIGPEHSWLHDVGRVEYAYATDQEALDAFQLCARTEGIIPAL
ESAHGLAEVIKRAPKLPKDHLMVLCLSGRGDKDIFSVAKHLGVEL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaactgaacacctaccgctccggtcccgacgagcgcgggcatttcggaatcttt
ggcggccgcttcgtcgccgagacgctgatgcccctgatcctggaggtcgagaaggcctat
cgcgaggcgcgcgccgatcccgccttcgaaggggagatgcgccagcagctgaagcaatat
gtcggccgccccaacccgctctattacgcggaacgcctgaccgagcagctgggcggcgcc
aagatctacttcaagcgcgaggagctgaaccacaccggcgcgcacaagatcaacaactgc
atcggccagatcctgctggcgcggcgcatgggcaagacccgcatcatcgccgagacgggc
gccggccagcatggcgtggcgaccgcgacggtctgcgcgctctatgacatgccctgcgtc
atctacatgggcgagaccgacatcgcccgccagcagcccaacgtcttccgcatgaagctg
ctgggcgccgaggtccgcccggtgacgtcgggcagcggcacgctgaaggacgcgatgaac
gaggcgctgcgcgactgggtcaccaacgtcgccgacaccttctacatcatcggcaccgcc
gccggcccgcacccttatcccgccatggtccgcgacttccagtcggtgatcggcgacgag
gtgcggacccagatgcaggagctggagggccgcctgcccgacagcctggtcgcctgtgtc
ggcggcggctccaacgccatcggcctgttccatcccttcctcgacgacccgtcggtgcag
atgatcggcgtcgaggccgccggccgcggcatcgagaaggggccgctcgaccatgccgcc
tcgatcaacggcggccgtcccggcgtgctgcacggcaaccgcacctatctgctgcaggac
gaggacggccagatcctggagggccactcgatctccgccggcctcgactatcccggcatc
gggccggagcatagctggctgcacgatgtcggccgcgtcgaatacgcctatgccaccgac
caggaggcgttggacgccttccagctctgcgcccgcaccgagggcatcatcccggcgctg
gaatccgcccacggccttgccgaggtgatcaagcgcgcgccgaaactgcccaaggaccac
ctgatggtgctgtgcctgtcgggccgcggcgacaaggacatcttctccgtcgccaagcat
ctgggagtggaactgtga

DBGET integrated database retrieval system