KEGG   Azospirillum sp. B510: AZL_027970Help
Entry
AZL_027970        CDS       T01169                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
azl  Azospirillum sp. B510
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AZL_027970
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AZL_027970
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AZL_027970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3217457..3218062
Genome map
AA seq 201 aa AA seqDB search
MTVRARLRTVALAAVLSLMGTASAMAANSAAPGSAAPGSAYDFTFQGIDGKPLPLSQFKG
KAILVVNTASQCGFTPQYKGLEALWQRYRDRGLVVVGVPSDDFGGQEPGTAGQIKDFCEV
NYSIDFPMTDKTVVSGDGAHPFYRWAADELGFLAKPRWNFHKYLVGPDGKLVSWFSTMTD
PEADKVREAIETLLPEKAPKS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccgagcccgccttcgcaccgtcgccctggcggcggtcctctccttgatggga
accgccagcgccatggccgcaaacagtgccgccccgggtagcgccgccccgggtagcgcc
tacgacttcaccttccagggcatcgacggcaagccgctgccgctgtcgcagttcaagggc
aaggcgatcctggtggtcaacaccgcctcgcaatgcggcttcaccccgcaatacaagggg
ctggaggcgctgtggcagcgctaccgcgaccgcgggctggtggtggtcggcgtgccgtcc
gacgatttcggcgggcaggagccgggaaccgccggccagatcaaggatttctgcgaggtc
aattacagcatcgacttcccgatgaccgacaagacggtggtgtcgggcgatggcgcccac
cccttctaccgctgggcggccgacgagctgggcttcctcgccaaaccgcgctggaacttc
cacaaatatctggtgggaccggacggcaagctggtgtcctggttctccaccatgaccgac
cccgaggccgacaaggtgcgcgaggcgatcgagacgctgctgccggagaaggcgccgaaa
tcgtag

DBGET integrated database retrieval system