KEGG   Azospirillum sp. B510: AZL_028440Help
Entry
AZL_028440        CDS       T01169                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
azl  Azospirillum sp. B510
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:azl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3264057..3264692)
Genome map
AA seq 211 aa AA seqDB search
MFRGPGLSRPDATADAARPSRAEAEEAVRTLIRWAGDDPTREGLVGTPDRVVRSYDEFFA
GYGIDPVEILSRTFEETDGYDEMVVLRDIRVESYCEHHMVPIIGKAHVAYLPRRRVVGIS
KLARLVEAYGKRLQIQEKMTAQIANTIDEVLQPEGVAVVIEAQHQCMTTRGVHKTGVTMV
TSRMLGAFRSDPSTRREFLTMIGNPSSRGGE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgttccgcggacccggcctgtcgcggccggatgccaccgccgatgccgcccgcccgtcc
cgcgccgaggcggaggaggccgtgcgcaccctgatccgctgggccggcgacgacccgacg
cgcgaggggctggtcggcacgccggaccgcgtcgtccgctcctatgatgaattcttcgcc
ggctatggcatcgatccggtcgaaatcctgtcgcgcaccttcgaggagaccgacggctac
gacgagatggtcgtgctgcgcgacatccgggtcgaatcctactgcgagcaccacatggtg
ccgatcatcggcaaggcccatgtcgcctatctgccgcgccgccgcgttgtcggcatctcc
aagctggcccggctggtcgaggcctatggcaagcgcttgcagatccaggagaagatgacg
gcgcagatcgccaacaccatcgacgaggtgttgcagcccgagggcgtggccgtggtgatc
gaggcgcagcaccagtgcatgaccacccgcggcgtccacaagaccggcgtgaccatggtg
accagccgcatgctgggcgccttccgcagcgacccgtcgacccgccgcgaattcctgacg
atgatcggcaacccgtcctcgcgcggcggggagtga

DBGET integrated database retrieval system