KEGG   Azospirillum sp. B510: AZL_a00430Help
Entry
AZL_a00430        CDS       T01169                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
azl  Azospirillum sp. B510
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZL_a00430 (malQ)
Enzymes [BR:azl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AZL_a00430 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510a:57508..59718
Genome map
AA seq 736 aa AA seqDB search
MSDLDRLADLLGLEPHYHDIWGNRRETSSATKRALIAAMGLPAATDEEVAASLRAVERRS
WTRPLPPVLVSGEGQEIGLGVALPAGLDDATLVWDLTPEGGSTRGGRVAVRDLPVTDRAT
IDGTSHERRALGALLPVSLPIGYHRLDVHVETTNGIGAGLSGSTTLIVTPEHCVTMEEMA
PGGRSWGIGLQIYSLRSEQDWGMGDFRDLAGFAEVAGRLGAGLVGLNPLHALFPADPNHI
GPYSPSSRQFLNILYIDPASVPEFSAPEGAGADDLHERIEAPAFQAALSAARRAELVDYP
AVAALKLPLLEALHTRFRALPDDAPRKAAYAAFRREMGTALDRHALFDALHEHFFRQDSA
QWMWRNWPAAFQNPQSAEVAAFAAEHADRVDFFAWAQFEADRQLGEAAGRGRAAGLAMGF
YRDLAVAAHPGGGSAWADPSMLVQGANVGAPPDQFNLKGQNWGLAPLSPLGLREAAYRPF
VELLRANMRHAAALRIDHVMALQHLFWIPEDGSDGAYVAYPFHDLLRIVALESRRSRCVV
IGEDLGTVPEGFRPALERAGILSYRVLYFERTADGGFKPPGDYPAGSMATVSTHDLAPFK
GFWTGRDLDWRQRLGLYPDDASRDKDRWDRGVDRWRLLQALSREGLRPDSYPTEDGAQPF
RVELSVAVHAFLAHTPSRIVMVQIEDAVADDEQPNLPGTVDQHPNWRRRLPCKLEELESN
NDFRLIIAPMADAVAR
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctcgaccggctggccgatctgcttggacttgaaccccactatcacgacatc
tggggcaaccggcgggagacctcttccgccaccaagcgggcgttgatcgcggcgatgggg
ctgccggccgctacggacgaggaggtcgccgccagcctgcgcgcggttgaacgccggtcc
tggacccgcccgctgccgccggtgctggtcagtggcgagggtcaggagatcgggctcggc
gtcgccctgccggccgggctcgacgatgccacgctggtctgggacctgacgccggagggc
gggagcaccaggggcggccgcgtcgcggtccgtgacctgccggtgaccgaccgcgcgacc
atcgatggcaccagccatgagcgccgggcgctgggcgccctgctgccggtgtcgctgccc
atcgggtatcaccggctggatgtgcatgtggagaccacgaacggcatcggcgccggcctg
tccggctccaccaccctgatcgtcacgcccgagcactgcgtgacgatggaggagatggcg
ccgggcggccgtagctggggcatcggcttgcagatctattccctgcggtcggagcaggat
tggggcatgggcgatttccgcgacctcgccggcttcgccgaggtcgccggacggctgggg
gccgggctggtcggcctgaacccgctgcacgccctgttcccggccgatccgaaccatatc
ggtccctattcgccgtccagccgccaattcctcaacatcctctacatcgacccggcctcc
gtccccgaattctccgcccccgaaggcgccggtgccgatgatctgcatgagcggatcgaa
gctccggcattccaggcggcgctgagtgccgcgcggcgggcggagctggtcgattatccc
gcggtcgccgccctgaagctgccgcttctggaggcgctgcatacccgtttccgcgcgctg
ccggacgatgccccgcgcaaggccgcctatgccgccttccggcgggagatgggcacggcg
ctggaccgccatgccctgttcgatgccctgcacgagcatttcttccgccaggattccgcg
caatggatgtggcggaactggccggccgccttccagaacccgcaaagcgccgaggttgcc
gcctttgccgccgagcatgccgaccgggtcgatttcttcgcctgggcgcagttcgaggcg
gaccgccagctgggcgaggcggcagggcggggaagggccgccgggcttgccatgggcttt
taccgcgaccttgccgtcgccgcccatcccggcggcgggtccgcctgggccgatccgtcg
atgctggtgcagggtgccaatgtcggggcgccgcctgatcagttcaacctgaagggccag
aattggggcttggcgccgctgtcgccgctcggcctgcgcgaggcggcctaccggcctttc
gtcgagcttctgcgcgccaacatgcgccatgccgcggcgctgcgcatcgaccatgtgatg
gcgttgcagcatctgttctggattccggaggatggcagtgatggcgcctatgtcgcctat
cccttccatgacctgttgcgcatcgtggcgctggagagccgccgcagccgctgtgtcgtg
atcggcgaggatctgggcacggtgccggagggcttccgtccggctttggagcgggccggc
atcctgagttaccgcgtgctctatttcgagcgcacggccgatggcggcttcaagcctccc
ggcgactatccggccggctcgatggcgacggtcagcacccatgatctggcgccgttcaag
gggttctggaccggccgcgatctcgactggcgtcagcgtctcggcctctatcccgacgac
gccagccgagacaaggaccgctgggaccgtggcgtcgaccgctggcgcctgttgcaggcc
ctgtcgcgggaggggctgcgtccggacagctatccgaccgaggatggagcccagcccttc
cgggtcgagctgtccgtcgccgtccatgcctttctggcgcatacgccgtcccgcatcgtg
atggtgcagatcgaggacgcggtggcggatgatgagcagcccaaccttcccggcacggtg
gaccagcatcccaattggcgcagacgccttccctgcaaactggaggaattggagagcaac
aacgatttccgccttatcatcgccccgatggcggatgccgtcgcgcgctga

DBGET integrated database retrieval system