KEGG   Azospirillum sp. B510: AZL_a00770Help
Entry
AZL_a00770        CDS       T01169                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
azl  Azospirillum sp. B510
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZL_a00770 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZL_a00770 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AZL_a00770 (thrC)
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AZL_a00770 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510a:complement(92628..93884)
Genome map
AA seq 418 aa AA seqDB search
MRFDSNLTVERPTFVTHLECAYTGERYEADTIHNLSRAGKPLLVRYDLNGVKQALTKSSL
SGRPQDLWRYRELLPVRRVEDIVSLGEAVTPLVPLNRLAKRLGAAELLVKDEGRLPTGSF
KARGLVMAVSMAKSFGITHMAMPTNGNAGAALAAYATRAGIRTTIFCPADTPEVNVSEIE
LQGATVYRVNGLIDDCGRIVGEGKAKVGWFDVSTLKEPYRIEGKKTMGLELAEQLGWEVP
DVIFYPTGGGTGLIGMWKAFAELEAIGFIGSKRPRMVAVQAAGCAPMVRAWELGEEHAPR
WEDAHTIASGIRVPQAVGDFLILRAVRESGGFAIAVPDDAIQAALNEVAREEGFLLCPEG
AATYAAYKQALADGRVGKEERAVLFNCATGLKYPLPPVRRTLDRTKPIDYSLFQNGGQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcttcgattccaacctgacggtcgaacgcccgaccttcgtcacccatctggaatgc
gcctacaccggcgaacgctacgaggccgacacgatccacaacctgtcgcgcgccggcaag
ccgctgctggtccgctatgacctgaacggcgtgaaacaggcgctgaccaaaagctccctg
tccggacgcccgcaggatctgtggcgctaccgcgagcttctgccggtccgccgggtcgag
gacatcgtcagcctgggagaggcggtgacgccgctggtgccgctgaaccggctggcgaag
cggctgggtgcagccgaactgctggtgaaggacgaggggcggctgcccaccggctccttc
aaggcacgcgggctggtgatggcggtgtcgatggcgaagtccttcggcatcacccacatg
gcgatgccgaccaacggcaatgccggggcggcgctggccgcctacgccacccgcgccggc
atccgcaccaccatcttctgtccggccgacacgcccgaggtgaatgtgtcggagatcgag
ttgcagggcgccaccgtctatcgggtcaacggactgatcgacgattgcggcaggatcgtc
ggcgagggcaaggccaaggtcggctggttcgacgtctccaccctgaaggagccctatcgg
atcgagggcaagaagacgatggggctggagctggccgaacagctgggctgggaggtgccg
gacgtcatcttctatccgaccggcggcggcaccggcctgatcggcatgtggaaggccttc
gccgagctggaggcgatcggcttcatcggctcgaagcgcccgcgcatggtggcggtgcag
gccgccggctgcgccccgatggtccgcgcctgggaactgggggaggagcacgccccgcgc
tgggaggacgcccacaccatcgcgtccggcatccgcgtgccgcaggcggtcggcgacttc
ctaatcctgcgcgccgtgcgcgagagcggcggcttcgccatcgccgtgcccgacgacgcc
atccaggccgccctgaacgaggtggcgcgggaggagggcttcctgctctgtccggagggg
gccgccacctatgccgcctacaaacaggcactggccgacggccgggtcggcaaggaggag
cgcgccgtgctgttcaactgcgccaccggcctgaaatacccgctgccaccggtgcgccgc
acgctcgaccgcaccaagcccatcgactactcactctttcagaacggcgggcaatga

DBGET integrated database retrieval system