KEGG   Azospirillum sp. B510: AZL_a03540Help
Entry
AZL_a03540        CDS       T01169                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
azl  Azospirillum sp. B510
Pathway
azl00020  Citrate cycle (TCA cycle)
azl00640  Propanoate metabolism
azl00660  C5-Branched dibasic acid metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01130  Biosynthesis of antibiotics
azl01200  Carbon metabolism
Module
azl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZL_a03540 (sucC)
   00640 Propanoate metabolism
    AZL_a03540 (sucC)
   00660 C5-Branched dibasic acid metabolism
    AZL_a03540 (sucC)
Enzymes [BR:azl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AZL_a03540 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAI73885
RhizoBase: AZLa03540
UniProt: D3NZQ6
Position
pAB510a:444219..445418
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKNLLRGYGVAVPRGGVAFTPEEAASVARELGGPVWVVKSQIHAGGRGAGRFQ
DNPGGKGGVRVVKSVEEVSSNAAEMLNHVLVTKQTGPAGKEVKRLYVEEGADIKRELYLG
LLTDRATGRVTIIASTEGGMEIEEVAHNTPEKIVKVAIDPATGIQGHHTRKVAFALGLEG
KQVASAAKFIQAAYKAFTELDCAIVEINPLIVTGSGDILALDAKMSFDDNALFRHKDVAA
LRDEAEEDPAEIEAAKHELNYVKLDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVGG
GATKERVTAAFKLILSDSAVEGILVNIFGGIMRCDVIAEGVVAAARDVKLHVPLVVRLEG
TNVALGKRILADSGLPILSADNLDDAAKKIVAAVKKEAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaatatcaggccaagaacctgctgcgggggtacggcgtcgccgttccg
cgtggcggcgtggccttcaccccggaagaggctgcatcggtcgcccgcgagctgggcggt
ccggtctgggtggtgaaatcgcagatccatgccggcggccgcggtgccggccgtttccag
gacaatccgggcggcaagggcggcgtccgtgtcgtcaagtcggtcgaagaggtttcctcc
aacgccgccgagatgctgaaccacgtgctggtgaccaagcagaccggcccggccggcaaa
gaggtcaagcgcctctatgtcgaggaaggcgccgacatcaagcgcgagctctatctcggc
ctgctcaccgaccgcgccaccggccgcgtcaccatcatcgcctcgaccgaaggcggcatg
gagatcgaggaggtcgcccacaacacgccggagaagatcgtcaaggtcgccatcgacccg
gccaccggcatccagggccaccacacccgcaaggtcgccttcgcgctcggcctggaaggc
aagcaggtggcatccgccgccaagttcatccaggccgcctacaaggccttcaccgagctc
gattgcgccatcgtcgagatcaacccgctgatcgtcaccggttcgggcgacatcctggcg
ctcgacgccaagatgagcttcgacgacaacgcgctgttccgtcacaaggacgtggcggcc
ctgcgcgacgaggccgaagaggacccggcggagatcgaggcggccaagcatgagctgaat
tacgtcaagcttgacggcaatatcggctgcatggtcaacggcgctggcctcgccatggcg
accatggacatcatcaagctctatggtgccgagccggccaacttcctcgacgtcggcggc
ggcgccaccaaggagcgcgtcaccgcggccttcaagctgatcctgtccgacagcgcggtc
gaaggcatcctggtcaacatcttcggtggcatcatgcgctgcgacgtgatcgccgagggc
gtggtcgccgcggctcgcgacgtgaagctgcatgttccgctggtggtgcggctggagggt
accaacgtggcgctcggcaagcggatcctggccgactccggcctgccgatcctgtccgcc
gacaatctggacgacgcagccaagaagatcgtcgccgccgtgaagaaggaggccgcgtga

DBGET integrated database retrieval system