KEGG   Azospirillum sp. B510: AZL_a04490Help
Entry
AZL_a04490        CDS       T01169                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
azl  Azospirillum sp. B510
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AZL_a04490 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    AZL_a04490 (nagZ)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AZL_a04490 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510a:550539..551615
Genome map
AA seq 358 aa AA seqDB search
MWGVWLSVPDLVGSATRVSRRRAVVFGCAGLAVTPDEAAFFRDADPLGFILFRRNCDSRD
QMRRLVDDLRASVGRADAPVLIDQEGGRVARMRPPHWPAHPPMGVFGTLARRDTAAALDA
AWINGRLLAHMLTEVGITVDCAPVCDVPVEGAHDIIGDRAFSRDPALVIALARATADGLL
AGGVLPVIKHIPGHGRAFADSHAELPVVEADRATLEATDFAPFRALADLPLAMVAHVVLK
AIDPEAPASTSAIVVREVVRGSPIGFGGLLFSDDLSMNALRGDPRSRAEAVLAAGMDVVL
HCNGDLAEMRSIVGAVPALSGLAAERWARAEALRHPPEPADIAALTNRLAELLGTART
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtggggtgtgtggttgtccgtccctgatttggtgggttccgccacccgggtttcccgt
cggcgcgcggtggtcttcggctgcgccgggctggcggtcacgcccgacgaggccgctttc
ttccgcgatgccgatccgctcggcttcatcctgttccgccgcaattgcgacagccgcgac
cagatgcgccggctggtcgatgacctgcgcgccagcgtcggccgggccgacgcccccgtt
ctgatcgaccaggagggcggccgggtcgcgcgcatgcgcccgccgcattggccggcgcac
ccgccgatgggggtgttcggcacgctcgccaggcgcgatacggccgccgcacttgatgcg
gcctggatcaatggccggctgctcgcccatatgctgacggaggtcggcatcacggtggat
tgcgcgccggtctgcgatgtgccggtcgaaggagcgcacgacatcatcggcgaccgcgcc
ttctcgcgcgatcccgccctggtgatcgcgctcgcccgcgccaccgccgacgggctgctg
gccggcggcgtgctgccggtgatcaagcacatccccggccatggccgcgccttcgccgac
agccatgccgagttgccggtggtggaggccgaccgcgcgacgctggaggccaccgatttc
gcgcccttccgcgcgctcgccgacctgccgctggcgatggtcgcccatgtggtgctgaag
gcgatcgatccggaggccccggctagtacctcggccatcgtggtgcgcgaggtggtgcgt
gggtcccccatcggcttcggcggcctgctgttcagcgacgatctgtcgatgaacgcgctg
cggggcgacccgaggtcgcgggccgaggcggtgctggcggcgggaatggatgtcgtgctt
cactgcaacggcgatctggccgagatgcgttcgatcgtcggcgccgttccggcgctgagc
gggctggcggcggagcgctgggcgcgggccgaggctctgcgccacccgccggaaccggcg
gacatcgccgcattgaccaaccggctggccgagcttctcggcacggcccgaacctga

DBGET integrated database retrieval system