KEGG   Azospirillum sp. B510: AZL_a06650Help
Entry
AZL_a06650        CDS       T01169                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
azl  Azospirillum sp. B510
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZL_a06650 (gpm)
   01230 Biosynthesis of amino acids
    AZL_a06650 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_a06650 (gpm)
  Energy metabolism
   00680 Methane metabolism
    AZL_a06650 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZL_a06650 (gpm)
Enzymes [BR:azl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AZL_a06650 (gpm)
Exosome [BR:azl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AZL_a06650 (gpm)
  Exosomal proteins of melanoma cells
   AZL_a06650 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510a:850783..851544
Genome map
AA seq 253 aa AA seqDB search
MHRLILLRHGQSVWNAEDRFTGWTDVGLTDRGIAETRRASDLLKAAGIDLDIAFTSVLSR
AIETLHLVLRDMDRLWLPVHKHWRLNERHYGALQGLNKTETAERHGVEQVFRWRRSWDIP
PPPIDPDDPRSAVTGRRYAGIARSNLPRGESLKDTTDRVVPFWRDEIAPALRLGARVLVS
AHGNSLRGLVKHLDAVADQDIPLFEIPTSRPLVYELGADLTPLRRYFLGENGAVEEIGWS
KDDPAGKGGNAAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcacagactaatcctgctgcgccatggtcagagcgtgtggaacgcggaagaccgcttc
acgggatggaccgatgtcggcctgaccgaccgtggcatcgccgagacccgccgggcctcg
gacctgctgaaggcggcgggcatcgatctcgacatcgccttcacctcggtgttgagccgc
gcgatcgagaccctgcatctggtgctgcgcgacatggatcgtctgtggctgcccgtgcac
aagcactggcgcctcaacgaacgtcattacggcgcgttgcaggggctgaacaagacggag
acggcggagcgccacggggtggaacaggtgttccggtggcggcggagctgggacatcccg
ccgccgccgatcgatcccgacgatccgcgatcggcggtgaccggccggcgctatgccggc
atcgcccgctccaacctgccgcgcggcgaaagcctgaaggacaccacagaccgggtcgtt
cccttctggcgcgacgagatcgctccggcattgcggttgggcgcccgcgtcctggtgtcg
gcccatggcaacagtctgcgcgggctggtcaagcatctcgacgccgtcgccgaccaggac
attccgctgttcgagattccgaccagccgcccgctggtctatgaactcggcgccgacctg
acgccgcttcgccgctatttccttggcgaaaacggcgcggtggaggagatcggctggtcg
aaggacgacccggcgggcaagggcggcaacgccgcggcgtga

DBGET integrated database retrieval system