KEGG   Azospirillum sp. B510: AZL_a08020Help
Entry
AZL_a08020        CDS       T01169                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
azl  Azospirillum sp. B510
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AZL_a08020 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_a08020 (adh)
   00620 Pyruvate metabolism
    AZL_a08020 (adh)
   00650 Butanoate metabolism
    AZL_a08020 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AZL_a08020 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AZL_a08020 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZL_a08020 (adh)
   00626 Naphthalene degradation
    AZL_a08020 (adh)
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AZL_a08020 (adh)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AZL_a08020 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510a:1056712..1059393
Genome map
AA seq 893 aa AA seqDB search
MVTTVKTLADLNALIARVKAAQQRFADYPQEKVDLIFRSAALAAANARIPLAKMAVEETG
MGVMEDKVIKNHFAAEYIYNKYKDDKTCGVLSEDNDAGILTIAEPVGLICGIVPTTNPTS
TAIFKALIALKTRNGLVISPHPRARKSTCEAARLVLAAAVEAGAPDDIIGWIDAPSLELS
NAVMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPAVIDEFADIKRAVASILMSK
TFDNGVVCASEQSAVVVDAVYDAVRDRFAHHGGYILSPREADAVRKVLLTDGHLNADIVG
QPAHAIAGMAGLNVPLATKVLIAEVTDIDDAEAFAHEKLSPTLALYRAKDFAEACDKAAA
LVALGGIGHTSVLYTDQDQKQDRVRHFGDRMKTARILINTPSSHGGIGDLYNFRLAPSLT
LGCGSWGGNSISENVGPQHLINKKTVAKRAENMLWHKLPKSIYFRRGCLPFALEELRGKK
RCLIVTDRFLFENGHVNDSVRVLKSLGLEVETFFEVSADPTLAVVRKGVALANAFQPDVI
LALGGGSPMDAAKIIWVMYEAPDVAFEDLALRFMDIRKRIYTFPKLGVKAQLVAVPTTSG
TGSEVTPFAVVTDERTGTKYPIADYELTPTMAIVDANLVMEMPKGLTAAGGIDAVTHALE
AYVSVVANEYSDGQALQALKLLKEHLPSAYRNGAQDPKARELVHNAATLAGIAFANAFLG
VCHSMAHKLGAEFHIPHGIANALLIANVIRYNAADIPTKQTAFSQYDRPKGVARYAQIAR
HLDLGGSRDHERVEKLIQWVEEMKRALDIPASIQAAGVAEAAFLAKVDALAEAAFDDQCT
GANPRYPLVAEIRQLLLDSYYGRAYAEPSAQDAAPVEAKPSAKAARKEAATAK
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccaccgttaagacccttgccgacctcaatgccctgatcgcgcgtgtgaaggcg
gcgcagcagcgcttcgccgactatccgcaggagaaggtcgacctgatcttccgcagcgcc
gccctggccgccgccaacgcccgcatcccgcttgccaagatggcggtggaggagaccggc
atgggcgtgatggaagacaaggtcatcaagaaccatttcgccgccgaatacatctacaac
aaatacaaggacgacaagacctgcggcgtcctttccgaggacaacgacgccggcatcctc
accatcgccgagccggtcggcctgatctgcggcatcgtccccaccaccaacccgacctcg
accgccatcttcaaggcgctgatcgcgctgaagacccgcaacggcctggtcatctccccc
catccccgcgcccgcaaatcgacctgcgaggccgcccgcctggtgctggccgccgcggtc
gaggccggcgcgcccgacgacatcatcggctggatcgacgcgccgtcgctggagctgtcc
aacgcggtgatgcaccacccggacatcaacctgatcctggcgaccggcggtccgggcatg
gtcaaggccgcctattcgtcgggcaagcccgccatcggcgtcggcgccggcaacaccccg
gcggtcatcgacgagttcgccgacatcaagcgcgccgtcgcctccatcctgatgtccaag
accttcgacaatggcgtcgtctgcgcctcggaacagtcggcggtggtggtcgacgccgtc
tatgacgcggtgcgcgaccgtttcgcccatcatggcggctacatcctgtcgccgcgcgag
gccgacgccgtgcgcaaggtcctgctgaccgacggccatctgaacgccgacatcgtcggc
cagccggcccacgccatcgccggcatggccgggttgaacgtgccgctcgccaccaaggtg
ctgatcgccgaggtcaccgacatcgacgatgccgaggccttcgcccatgaaaagctgtcg
ccgaccctggcgctctaccgcgccaaggacttcgccgaggcctgcgacaaggccgccgcc
ctggtggcgctgggcggcatcggccacacctcggtcctctacaccgaccaggaccagaaa
caggaccgcgtccgccatttcggcgacaggatgaagaccgcccgcatcctgatcaacacg
ccctcctcccatggcggcatcggcgatctctacaatttccgtctggccccgtcgctgacg
ctgggctgcgggtcgtggggcggcaactcgatctccgagaatgtcgggccgcagcacctg
atcaacaagaagacggtggcgaagagggcggagaacatgctgtggcacaagctgcccaaa
tcgatctatttccgccgcggctgcctgcccttcgcgctggaggaactgcgcggcaagaag
cgctgcctgatcgtcaccgaccgtttcctgttcgagaacggccatgtcaacgacagcgtg
cgcgtcctgaaatcgctgggccttgaggtcgagaccttcttcgaggtcagcgccgacccg
acgctggcggtggtgcgcaagggcgtggcgctcgccaacgccttccagcccgacgtcatc
ctggcgctgggcggcggctcgccgatggacgcggccaagatcatctgggtgatgtacgag
gcgcccgacgtggcgttcgaggatctggccctgcgcttcatggacatccgcaagcgcatc
tacaccttccccaagctgggggtgaaggcgcagctggtggcggtgccgaccacctcgggc
accgggtcggaggtcacccccttcgccgtggtgaccgacgagcgcaccggaaccaaatat
ccgatcgccgattacgagctgacgccgacgatggcgatcgtcgacgccaatctggtgatg
gagatgcccaaggggctgacggcggccggcggcatcgacgcggtgacccatgcgctggag
gcctatgtctcggtggtggccaacgaatattcggacggccaggcgctccaggcgctgaag
ctgctgaaggagcatctgccctcggcctaccgcaacggggcgcaggacccgaaggcgcgc
gagctggtgcacaatgcggccacgctggccggcatcgccttcgccaacgccttcctcggc
gtctgccattcgatggcgcacaagctgggggcggagttccacatcccgcacggcatcgcc
aacgccctgctgatcgccaacgtcatccgctacaacgcggcggacatcccgaccaagcag
acggcgttcagccagtatgaccggcccaagggggtggcgcgctatgcccagatcgcccgc
cacctcgatctcggcggcagccgcgaccatgagcgggtcgagaagctgatccagtgggtc
gaggagatgaagcgggcgttggacatcccggcctcgatccaggcggcgggcgtggcggag
gcggccttcctcgccaaggtcgacgcgctggccgaggcggccttcgacgaccagtgcacc
ggcgccaacccgcgctatccgctggtggcggagatccggcagctgctgctcgacagctat
tacggccgcgcctatgccgaaccgtcggcccaggacgcggcaccggtcgaggccaagcct
tccgcgaaagccgcccgcaaggaagcggcgacggccaaataa

DBGET integrated database retrieval system