KEGG   Azospirillum sp. B510: AZL_a08690Help
Entry
AZL_a08690        CDS       T01169                                 

Definition
protein-glutamate methylesterase, two-component system, chemotaxis
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZL_a08690
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZL_a08690
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZL_a08690
Two-component system [BR:azl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AZL_a08690
Bacterial motility proteins [BR:azl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZL_a08690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510a:complement(1139742..1140872)
Genome map
AA seq 376 aa AA seqDB search
MSQKIRVLIVDDSATVRQTLTDILSSDPMIEVMGTAADPYAAVRRIAKEEPDVITLDVEM
PRMDGITFLRKLMSQHPIPVVMCSSLVEGGSETLMQALEAGATDVILKPRIDTRQSLLDA
QVRICDTVKAAAHARPRQRATTGPASASATPAATPAITPLGRTRAPEPKLSADVMLPAPS
GGAMARTTERVICIGASTGGTEALREVLQALPADCPGIVIVQHMPESFTAAFARRLDSLC
EVTVREARDGDTVLRGQVLIAPGNRHMLLQRSGARYLVAVKEGPLVSRHRPSVDVLFRSA
AHCAGGNAVGVIMTGMGDDGATGMREMHQAGAFTVAQDEESCVVFGMPKEAIARGGVDKV
VGLSSITREILRHDRS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaagattcgcgtgctgatcgtcgatgattccgcgaccgtccgccagaccctg
accgacatcctgtcgtcggatccgatgatcgaggtcatggggacggcggccgatccctac
gccgccgttcgccgcatcgcgaaggaggagccggacgtcattacgctggacgtcgagatg
ccgcgcatggacggcatcacctttctgcgcaagctgatgagccagcatccgatccccgtc
gtgatgtgctcctcgctggtggagggcggcagcgagacgctgatgcaggcgctggaggcc
ggcgccaccgacgtgatcctgaagccgcggatcgacacccgccagagcctgctcgacgcc
caggtccgcatctgcgacacggtgaaggcggcggcccacgcccgcccgcgccagcgcgcc
accaccggcccggcatccgcgtccgccacgcccgccgccactccggccatcacccctctt
ggccgcacccgcgccccggaaccgaaactgagcgccgacgtgatgttgccggcccccagc
ggcggggcgatggcccgcaccaccgagcgtgtgatctgcatcggcgcgtcgaccggcgga
accgaggcgctgcgcgaggtgttgcaggcgctgcccgccgactgccccggcatcgtcatc
gtccagcatatgccggaaagcttcaccgccgccttcgcccgccggctcgacagcctgtgc
gaggtgacggtgcgcgaggcgcgcgacggcgataccgtgctgcgcgggcaggtgctgatc
gcgccgggcaaccgccatatgctgttgcagcgcagcggcgcccgctatctggtggcggtc
aaggaggggccgctggtgtcgcgccaccgtccgtcggtcgacgtcctgttccgctccgcc
gcccattgcgccggcggcaacgcggttggtgtcatcatgaccgggatgggcgacgacggc
gccaccgggatgcgggagatgcatcaggccggcgccttcaccgtggcccaggatgaggag
agttgtgtcgtcttcggcatgccgaaggaggccattgcgcggggcggggtggacaaggtg
gtcggactctcatcgatcacccgcgagatcctgcgtcatgaccgttcgtga

DBGET integrated database retrieval system