KEGG   Azospirillum sp. B510: AZL_a10390Help
Entry
AZL_a10390        CDS       T01169                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AZL_a10390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510a:complement(1334152..1335015)
Genome map
AA seq 287 aa AA seqDB search
MTADRTIFLQGAGIGRHRPGVLLIHGLGGTPVELKTLGRRLQDAGLTVLCCQLAGHCGTA
EELTATGWRDWYASVEAGLNRLETVCDSVSVGGLSMGALLAARLAWAEPQRVRSLVMLAP
TLWYDGWAIPFYSFLLKFVIHLPFGRRYSFVERDPYGVKDPRIRALVLRAMQSGDASGAG
LLSTPATAIREIWRLTAELRPLLPDVRQPTLLVHAREDDTAGLSNAFHLQARLGGRVEAL
ILEDSYHLVTVDRQRDLVARRVAEFLATLAAGPDASVQPLRSEGAAP
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggatcggacgatttttctgcaaggggcgggcatcggccgccatcggcccggc
gttctgctgatccatgggctgggcggcacgccggtggagctgaagacactgggccgccgg
ttgcaggatgccgggctcaccgtgctgtgctgccagctcgccggccattgcggcacggcg
gaggagctgacggcgaccggctggcgtgactggtacgccagcgtggaggccggtttgaac
cggctggagacggtttgcgattccgtttcggtcggcgggctgtcgatgggggcgttgctc
gccgcccgcctcgcctgggcggagccgcagcgggtgcgcagcctggtcatgctggcgccg
acgctgtggtatgacggctgggcgatccccttctacagcttcctgctgaaattcgtgatc
cacctgccgttcgggcggcgctattccttcgtggagcgcgatccctacggcgtgaaggat
ccgcgcatccgggcgctggtgctgcgcgcgatgcagagcggcgacgcgagcggtgccgga
ctgctctccacccccgccaccgccatccgcgagatctggcggctgacggcggagttgcgc
ccgctgctgcccgatgtccgccagccgaccctgctggtccatgcgcgggaggacgacacg
gcgggcctgtccaacgccttccatctccaggcgcggctcggcggacgggtcgaggcgctg
atcctggaggattcctaccatctggtgaccgtcgaccgtcagcgcgacctcgtcgcccgc
cgagtcgccgaatttctcgcgacgctcgccgccggccccgacgcgtccgtccagccgctc
cgctccgagggcgccgccccatga

DBGET integrated database retrieval system