KEGG   Azospirillum sp. B510: AZL_b00670Help
Entry
AZL_b00670        CDS       T01169                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
azl  Azospirillum sp. B510
Pathway
azl00010  Glycolysis / Gluconeogenesis
azl00020  Citrate cycle (TCA cycle)
azl00620  Pyruvate metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01130  Biosynthesis of antibiotics
azl01200  Carbon metabolism
Module
azl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_b00670 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AZL_b00670 (pdhC)
   00620 Pyruvate metabolism
    AZL_b00670 (pdhC)
Enzymes [BR:azl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZL_b00670 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: BAI74730
RhizoBase: AZLb00670
UniProt: D3P3J1
Position
pAB510b:complement(80236..81018)
Genome map
AA seq 260 aa AA seqDB search
MRSIQTMTATDPTKSSAAAPTPQFDFSVYGEVETVPLTRLQILAGAALTRNSVAIPHVTH
HDDADITELEALRRRLAEDDSAVKITPLIFLIKGVAAVLKAYPRFNASLDPSGKQLILKK
YINIGIAIDTPNGLLVGVVRDCDRKGWRELAAEVATLSAKAREKGLPLAEMSGGCFTISS
LGGLGGTGFTPIINAPEVAILGVGRNRPVPRPDETGGIDWRTMLPLSLSYDHRVINGADA
ARFTSHLAALLADPATLIDV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgagatccatacagacgatgactgcgaccgacccgaccaaatcctccgccgctgccccc
acgccacagttcgacttttccgtttatggcgaggttgaaaccgtgccgttgacgcgcctt
cagattctggctggggctgccctcacccgcaatagcgtggcgatcccccatgtcacccat
catgacgacgccgacattacggagctggaggccttgcgccgccgtctggcggaggacgac
tccgcagtgaagatcacgccgctgatctttctgatcaagggcgttgcggcagtgctgaag
gcctacccgcgcttcaacgcttcgctggatccgtccgggaaacagctgatcttgaagaaa
tacatcaacatcggaatcgccatcgacacgccgaatggcctgctggtcggtgtggtgcgc
gattgcgatcgcaagggctggcgcgaactggcggccgaggttgcgaccctgtcggccaag
gcgcgcgagaaaggattgccgcttgcggaaatgtccggcggctgcttcaccatcagctcg
cttggcgggctcggcggcaccggcttcaccccgatcatcaatgcgccggaggtggcgatc
ctcggagtcggtcgcaaccgtcctgtgccgcgtcctgacgaaaccggcgggatcgactgg
cgtaccatgctgccgctgtcgctcagctacgatcaccgcgtcatcaatggggcggatgcc
gcccgttttaccagccatctcgcagcgcttctagccgatcccgccaccttgattgatgtg
tga

DBGET integrated database retrieval system