KEGG   Azospirillum sp. B510: AZL_b02460Help
Entry
AZL_b02460        CDS       T01169                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
azl  Azospirillum sp. B510
Pathway
azl00260  Glycine, serine and threonine metabolism
azl00750  Vitamin B6 metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01230  Biosynthesis of amino acids
Module
azl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZL_b02460 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AZL_b02460 (thrC)
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AZL_b02460 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAI74909
RhizoBase: AZLb02460
UniProt: D3P289
Position
pAB510b:complement(268857..270113)
Genome map
AA seq 418 aa AA seqDB search
MRFDSNLTVERPTFVTHLECAYTGERYEADTIHNLSRAGKPLLVRYDLNGVKQALSKSAL
SERPQDLWRYRELLPVRRVENIVSLGEAVTPLVPLPRIAQRLGAAELLVKDEGRLPTGSF
KARGLVMAVSMAKSFGITHMAMPTNGNAGAALAAYATRAGIRTTIFCPADTPEVNVSEIE
LQGATVYRVNGLIDDCGRIVGEGKGKVGWFDVSTLKEPYRIEGKKTMGLELAEQLGWEVP
DVIFYPTGGGTGLIGMWKAFAELEAIGFIGSKRPRMVAVQAAGCAPMVRAWERGEEHAPR
WEDAHTVASGIRVPQAVGDFLILRAVRESGGFAIAVPDDSIQAALDEVAREEGFLLCPEG
AATYAAYKQALADGRVGKDERAVLFNCATGLKYPLPPVHRTLDRTKPIDYSLFQENGR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcttcgattccaacctgacggtcgagcgcccgaccttcgtcacccatctggaatgc
gcctacaccggcgaacgctacgaggccgacacgatccacaacctgtcgcgcgccggcaag
ccgctgctggtccgctatgacctgaacggcgtcaagcaggcgctgagcaagagcgccctt
tccgaacgcccgcaggatctgtggcgctaccgcgagcttctgcccgtccgccgggtcgag
aacatcgtcagcctgggcgaggcggtcaccccgctggtcccgcttccccgcatcgcccag
cggctgggtgccgccgaactgctggtgaaggacgaggggcggctgcccaccggctccttc
aaggcgcgcgggctggtgatggcggtgtcgatggcgaagtccttcggcatcacccacatg
gcgatgccgaccaacggcaatgccggggcggcgctggccgcctacgccacccgcgccggc
atccgcaccaccatcttctgtccggccgacacgcccgaggtgaatgtgtcggagatcgag
ttgcagggcgccaccgtctatcgggtcaacgggctgatcgacgattgcggcaggatcgtc
ggcgagggcaagggcaaggtcggctggttcgacgtctccaccctgaaggagccgtaccgg
atcgagggcaagaagacgatggggctggagctggccgaacagctgggctgggaggtgccg
gacgtcatcttctatccgaccggcggcggcaccggcctgatcggcatgtggaaggccttc
gccgagctggaggcgatcggcttcatcggctcgaagcgcccgcgcatggtggcggtccag
gccgccggctgcgccccgatggtccgcgcctgggagcggggggaggagcatgccccgcgc
tgggaggatgcccacaccgtcgcgtccggcatccgcgtgccccaggcggtcggcgatttc
ctgatcctgcgcgccgtgcgcgaaagcggcggcttcgccatcgccgtgcccgacgattcc
atccaggccgcgctggacgaggtggcgcgcgaggagggcttcctgctctgccccgagggt
gccgcgacctatgccgcctacaaacaggcgctcgccgacggccgggtcggcaaggacgag
cgggcggtgctgttcaactgcgccaccggcctgaaatatccgctgcccccggtccatcgg
accctcgaccgcaccaagcccatcgactattcgctttttcaggaaaacggccgatga

DBGET integrated database retrieval system