KEGG   Azospirillum sp. B510: AZL_b03840Help
Entry
AZL_b03840        CDS       T01169                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
azl  Azospirillum sp. B510
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZL_b03840 (speB)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AZL_b03840 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510b:431141..432190
Genome map
AA seq 349 aa AA seqDB search
MIDPDKLNRLREKYSGGGGSDIHSPEFKQVAALQFSGGRRKQPFSGVPTLLNAPYDPDAA
AQPDFGGLEVALIGVPMDLGVTNRSGARFGPRALRTIERIGPYNHVLRMVPSAACRLADI
GDVPLSSRFDLEACHHDIESFYDKVREAGVIPLSVGGDHSISQSILKALGRERPVGMIHF
DAHCDTSGPYEGSKFHHGGPFRQAVLDGVLDPERTVQIGIRGSSEYLWEFSYESGMTVIH
AEEVAQLGIPAVIEQARKVAGDGPVYVSFDVDCLDPVFAPGTGTPEIGGLTTREAIEILR
GLNGLDVIGGDVVEVAPQYDANTNTAQAGAQMLFEILCLAAKALELRRG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatccggacaagctcaaccgtctgcgcgagaaatacagcggcggcggcggctcc
gacatccattcgccggaattcaagcaggtcgccgccctgcaattctccggcggacggcgc
aaacagcccttctccggcgtgccgaccctgctgaacgcgccgtacgacccggatgccgcc
gcccagccggatttcggcgggctggaggtggcgctgatcggcgtgccgatggatctgggc
gtgaccaaccggtcgggcgcccgcttcggcccgcgggcgctgcggacgatcgaacggatc
ggcccctacaaccatgtcctgcggatggtgccgtcggcggcctgccggctggccgatatc
ggcgacgtaccgctgtccagccgcttcgacctggaagcctgccaccacgacatcgagagc
ttctatgacaaggtgagggaggccggggtgatcccgctgtcggtcggcggcgatcattcg
atcagccagtcgatcctgaaggcgctgggccgcgaacgcccggtcggcatgatccatttc
gacgcccattgcgacaccagcggcccctatgagggctccaagttccaccatggcggcccc
ttccgccaagcggtgctcgacggtgtgctcgacccggaacgcacggtgcagatcggcatc
cgcggcagctccgaatatctgtgggagttctcctacgaatccggaatgacggtgatccat
gccgaggaggtggcgcagctcggcattcccgcggtgatcgagcaggcccgcaaggtggcc
ggcgacgggccggtctatgtctccttcgacgtcgattgcctcgacccggtcttcgccccc
ggcaccggcacgccggagatcggcgggctgaccacgcgggaggccatcgagatcctgcgc
ggcctgaacgggctcgacgtcatcggcggcgacgtggtcgaggtggcgccgcaatatgac
gccaacaccaacaccgcccaggccggggcgcagatgctgttcgagatcctctgcctcgcc
gccaaggcgttggagctgcggcggggctga

DBGET integrated database retrieval system