KEGG   Azospirillum sp. B510: AZL_b03890Help
Entry
AZL_b03890        CDS       T01169                                 

Definition
urea carboxylase (EC:6.3.4.6)
Orthology
K01941  
urea carboxylase [EC:6.3.4.6]
Organism
azl  Azospirillum sp. B510
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:azl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510b:complement(436920..440606)
Genome map
AA seq 1228 aa AA seqDB search
MFTKVLIANRGEIACRVIRTLDRMGIASVAVHSEADAQSLHVALAGEAVRIGPAAVSESY
LNAERILAAAKETGAQAIHPGYGFLSENPGFAEACAAAGITFIGPTPEQMRAFGLKHSAR
ALAERSGVPLSPGSGLLTDAAHARAEAARIGYPVMIKSTAGGGGIGMQLCREPETLEPMF
EAVSRLSRNNFKDGGVFLEKFIERARHIEVQIFGDGQGGVVALGERDCSAQRRNQKVIEE
TPAPGIGDDLRRKLFDAAERLGRAVNYQSAGTVEFVYDEAAGEAYFLEVNTRLQVEHGVT
EEVTGIDLVEWMIRQAAGEALPLEDHRNKARGASIQVRVYAEDPGRNFRPCSGLLTEVVF
PEGARVETWVEQGSEVTPFYDPLVAKIIVRGEDRADALAKLRDALARCRLSGIETNLAYL
RQLAADPVFAAGGITTRYLETVAYAARTLEVVTPGTLTTVQDHPGRVGYWEVGVPPSGPM
DPLAFRLGNRALGNPDGAAGLEITVSGPTLRFNAEAVVCLTGAAMPADLDGAPVPFWQPV
SVPAGAMLRIGTVSDAGCRAYLLVQGGLDVPDYLGSKSTFTLGKFGGHGGRALLPGDILH
LGDMPAGAAEAVSMEERPAYGRYWEIGVLYGPHGAPDFFTDDDIATFFAADWEVHYNSSR
TGIRLIGPKPAWARKDGGEAGLHPSNIHDNAYAIGAIDFTGDMPVILGPDGPSLGGFVCP
ATIVHAELWKIGQLRPGDTVRFKRLTADEATKLEEAIFPSPVPGEGGAHAQAWEGEGASK
THAPVPCAPLTRRSAPPSPGAGEGKSDSPILHRIPATASRPAVVYRRAGDKYLLIEYGPL
VLDLDLRFRVHALQTWLRAQALPGILDLTPGIRSLQIHYDSRRLPLGPLLDRLVGAEDEL
AAIDDLEVPTRIIHLPLSWDDEATRLAISKYMQSVRADAPWCPSNIEFIRRINGLDDVEA
VKRIVFDASYLVLGLGDVYLGAPVATPVDPRHRLVTTKYNPARTWTPENAVGIGGAYMCV
YGMEGPGGYQFVGRTCQMWNTHRTTDAFEPGKPWLLRHFDQIRFHPVSHDELMAFRADFP
LGRASLRIEEESFRLADYRRFLAENRDGIAAFKTRQQTAFEAERARWEASGQIGYAAELP
DGAGAEAEADLPPGGEAVPSPVPGSVWKIAARPGSAVKAGDPLLIVESMKMEIPVAAPMA
GTVAEIRCAEGQAVTLGQTLAVLLPETA
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaaggtcctgatcgccaaccgcggcgagatcgcctgtcgcgtcatccgcacg
ctcgaccgcatgggcatcgcctcggtcgccgtgcattccgaggccgacgcccagtccctg
catgtggcgctggcgggggaggccgtccgcatcggccccgccgcggtgtcggagagctat
ctgaacgccgagcgcatcctggcggcggcgaaggagaccggcgcccaggcgatccatccc
ggctatggcttcctgtcggagaatcccggcttcgccgaggcctgtgccgccgccggcatc
accttcatcgggccgacgccggagcagatgcgcgccttcgggctgaagcacagcgcccgc
gcgctggcggagcgcagcggcgtgccgctctctcccggcagcggcctgctgaccgatgcc
gcgcatgcgcgggcggaggcggcccgcatcggctatccggtgatgatcaagagcacggcc
ggcggcggcggcatcggcatgcagctgtgccgggaaccggaaacgctggaaccgatgttc
gaggcggtcagccggctgtcgcgcaacaacttcaaggatggcggcgtcttcctggagaag
ttcatcgaacgcgcccgtcacatcgaggtgcagatcttcggcgatggacagggtggcgtg
gtggcgctgggcgagcgcgactgctccgcccagcggcgcaaccagaaggtcatcgaggag
acgccggcccccggcatcggcgacgacctgcgccgcaaactgttcgacgcggcggagcgg
ctgggccgcgccgtgaattaccagtcggccggcacggtggagttcgtctatgacgaggcg
gcgggcgaggcctatttcctggaggtcaacacccgccttcaggtcgagcatggcgtgacc
gaggaggtcaccggcatcgacctcgtcgaatggatgatccggcaggcggccggcgaggcg
ctgccgctggaggatcatcgcaacaaggcgcggggcgcctcgatccaggtccgggtctat
gccgaggatcccggccgcaatttccgcccctgctccggcctgttgaccgaggtggtgttc
ccggaaggcgcccgcgtcgagacctgggtggaacagggcagcgaggtgacgcccttctac
gatccgctggtcgccaagatcatcgtgcgcggcgaggaccgcgccgacgccctggcgaag
ctgcgcgacgcgctggcccgctgccgcctgtcggggatcgagaccaacctcgcctatctg
cgccagctcgccgccgatccggtcttcgcggccggtggcatcaccacccgctatctggaa
acggtggcctatgcggcgcgcacgctggaggtcgtcacccccggcacgctgaccacggtg
caggaccatcccggccgcgtcggctattgggaggtcggcgtgccgccgtcgggcccgatg
gatccgctggccttccggctcggcaaccgcgcgctcggcaacccggacggggcggcgggg
ctggagatcaccgtgtccggcccgacgttgcgcttcaacgccgaggcggtggtctgcctg
accggtgcggcgatgccggccgatctcgacggcgcgccggtgcccttctggcagccggtc
agcgtgccggcgggggccatgttgcgtatcggcaccgtcagcgatgccggttgccgcgcc
tatctgctggtgcaaggcgggctggacgtgccggactatctcggcagcaagtccaccttc
acgctcggcaaattcggagggcatggcgggcgggcgctgctgccgggcgacatcctgcat
ctcggcgacatgccggccggtgcggcggaagcggtctccatggaggagcggccggcttac
ggacggtattgggaaatcggcgtcctctatggcccgcatggtgcgccggatttcttcacc
gacgacgacatcgccaccttcttcgccgccgactgggaggtgcattacaattccagccgc
accggcatccggctgatcggcccgaagccggcctgggcgcgcaaggacggcggcgaggcc
gggctccacccgtccaacatccacgacaacgcctatgccatcggcgccatcgacttcacc
ggcgacatgccggtgatcctcgggccggacggtcccagcctgggcggcttcgtctgtccg
gcgaccatcgtccatgccgagctgtggaagatcggccagctgcggccgggcgacacggtg
cggttcaaacggctgacggcggatgaggcgacgaagctggaggaggcaatcttcccctct
cccgtcccgggagagggaggggcccacgcgcaagcgtgggagggtgagggcgcatccaag
actcacgcgcctgttccttgcgcacccctcacccggcgctccgcgccaccctctcccggg
gcgggagagggaaagagcgactcccccatcctccaccgcatcccggcgaccgccagccgc
ccggccgtggtctaccgccgggccggcgacaagtatctgctgatcgagtacggcccgctg
gtgctggacctcgacctgcgcttccgcgtccatgcgctccaaacatggttgcgggcgcag
gcgctgccggggatcctcgacctgacgccgggcatccgctcgctccagatccattacgac
agccgccggctgccgctgggcccgctgctcgaccggctggtcggcgccgaggacgagttg
gcggccatcgacgatctggaggtgccgacccgcatcatccacctgccgctgtcctgggac
gacgaggccacccgcctcgcgatctccaaatacatgcagtcggtgcgcgccgacgccccc
tggtgcccgagcaacatcgagttcatccgccgcatcaacgggctggacgacgtcgaggcg
gtgaagcgcatcgtcttcgacgccagctatctcgtgctgggtctgggggacgtctatctc
ggggcgccggtggcgacgccggtcgatccgcgccatcgcctcgtcaccaccaaatacaac
ccggcccgcacctggacgccggagaacgcggtgggaatcggcggcgcctacatgtgcgtc
tatggcatggaggggccgggcggctaccagttcgtcggccgcacctgccagatgtggaac
acccaccggacgaccgacgccttcgagccgggcaagccctggctgctgcgccatttcgac
cagatccgcttccatcccgtcagccatgacgagctgatggccttccgcgccgacttcccg
ctcggccgggccagtctgcgcatcgaggaggagagcttccgtctcgccgactatcgccgc
ttcctggcggagaaccgcgacggcatcgccgccttcaagacgcgccagcaaacggccttc
gaggcggagcgggcgcgctgggaggcgtccggccagatcggctacgcggcggagctgccg
gacggcgccggtgcggaggccgaagccgacctgccccccggcggcgaggcggtgccgagc
ccggtgccgggcagcgtctggaagatcgcagcacggccgggcagcgcggtcaaggccggc
gacccgctgctgatcgtggaatcgatgaaaatggaaatccccgtcgccgcgccgatggcc
ggcacggtcgccgagatccgctgcgccgaggggcaggcggtgacgctgggccagaccctg
gccgtcctgctgcccgaaaccgcctga

DBGET integrated database retrieval system