KEGG   Azospirillum sp. B510: AZL_b04690Help
Entry
AZL_b04690        CDS       T01169                                 

Gene name
aor
Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
azl  Azospirillum sp. B510
Pathway
azl00030  Pentose phosphate pathway
azl01100  Metabolic pathways
azl01120  Microbial metabolism in diverse environments
azl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZL_b04690 (aor)
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AZL_b04690 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: BAI75132
RhizoBase: AZLb04690
UniProt: D3P2W2
Position
pAB510b:526415..528220
Genome map
AA seq 601 aa AA seqDB search
MHGWIGRILRIDLGTGKVSTEALKPELARDYIGARGLGTKYMYDEVDPMVDPLSPANKLI
FASGPMTGTFAPSAGRYDVVTKGPLTGTIAASNSGGAWGPELKYAGYDMLILEGRAEKPV
YLWIQDEKVEIRDAAHLWGKDVPETTEALNAETAADAKIACIGPAGENLSFIAAIMNDMQ
RAAGRTGVGAVMGSKNLKAVVVRGTGAVTVADKDAFLAAVAKASTMIKEHPVGGTGLRLY
GTNVLVNILNSVGGLPTANFQDGHYPTADKVGGETLAANQLQRPKGCFSCIISCGRATKV
TNPKYKGEGEGPEYETAWGFGPDCLIDDLDAVLKANYYCNEYGIDTISMGGTVACAMELF
HRGVITLEDTEGLELDFGNAEAMVEAVRLTGLGQGFGRKLALGSYRLASLYGHPELSMTV
KKQEMPAYDPRAVQGIGLNYATNNRGGCHVRGYSISPEVLGVPFKVDKDTIDGKAELVAL
FQNLTAALDSTGSCLFTTFGIGAPEFAELMTSLTGFAYTGESFVEAGERVWNLERLWNLK
SGLTAADDTLPPRLLKEPIVTGASKGAVSRLPEMLPLYYGVRGWDADGVPTKEKLSALAL
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcatggctggattggcaggatccttcggatcgacctcggcaccggcaaggtctcgacc
gaagcgctgaagcccgaactggcgcgcgactatatcggcgcccgcgggctgggcaccaaa
tacatgtatgacgaggtcgatccgatggtcgacccgctgtcgcccgccaacaagctgatc
ttcgcgtcggggccgatgaccggcaccttcgcgccgtcggccggacgctacgacgtcgtc
accaaggggccgctgaccggcaccatcgccgcgtcgaattccggcggcgcctggggaccg
gagctgaaatatgccggctacgacatgctgatcctcgaaggccgggcggaaaagccggtc
tatctgtggatccaggatgaaaaggtggagatccgcgacgccgcccatctgtggggcaag
gacgtgccggaaaccaccgaggcgctgaacgcggagacggcggccgacgccaagatcgcc
tgcatcggcccggccggcgaaaacctctccttcatcgccgccatcatgaacgacatgcag
cgcgccgccggccgcaccggcgtcggcgcggtgatgggatcgaagaacctgaaggcggtg
gtggtgcgcggcaccggcgccgtcaccgtcgccgacaaggacgccttcctggctgcggtg
gccaaggccagcaccatgatcaaggagcatccggtcggcggcaccggcctgcggctctac
ggcaccaacgtgctggtcaacatcctgaactcggtcggcggcctgccgaccgccaatttc
caggacggccattacccgaccgccgacaaggtggggggcgagacgctggcggccaaccag
ttgcagcggccgaagggctgcttctcctgcatcatctcctgcggccgcgccaccaaggtc
accaatcccaaatacaagggcgagggcgaggggccggaatacgaaaccgcctggggcttc
ggcccggactgcctgatcgacgatctcgatgcggtgctgaaggccaattattactgcaac
gaatacggcatcgacaccatctcgatgggcggcaccgtcgcctgcgccatggagctgttc
catcgcggcgtcatcacgctggaggacaccgaggggctggagctcgacttcggcaatgcc
gaggcgatggtggaggcggtgcggctgaccggcctcggtcagggcttcggcaggaagctg
gcgctgggctcctaccggctggccagcctctacggccatcccgaactgtcgatgacggtc
aagaagcaggagatgccggcctatgatccgcgcgcggtgcagggcatcgggctgaattac
gccaccaacaaccgcggcggctgtcacgtccgcggctattcgatcagccccgaggtgctg
ggcgtgcccttcaaggtcgacaaggacaccatcgacggcaaggcggagctggtggccctg
ttccagaacctgacggcggcgctggattccaccggttcgtgcctgttcaccaccttcggc
atcggcgccccggaattcgccgagctgatgacctcgctcaccggcttcgcctatacgggc
gagagcttcgtcgaggcgggcgagcgggtgtggaacctggagcggttgtggaacctgaag
tccggcctgaccgccgccgacgacacgctgccgccgcgcctgctgaaggagccgatcgtg
accggtgcctccaagggggcggtcagccgcctgccggaaatgctgccgctctattacggc
gtccgcggctgggatgccgatggcgttcccaccaaggaaaagctgagcgcgctggcgctg
gcctga

DBGET integrated database retrieval system