KEGG   Azospirillum sp. B510: AZL_b04890Help
Entry
AZL_b04890        CDS       T01169                                 

Gene name
arg
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
azl  Azospirillum sp. B510
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZL_b04890 (arg)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZL_b04890 (arg)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AZL_b04890 (arg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510b:549050..550000
Genome map
AA seq 316 aa AA seqDB search
MSYHKTKTKQCRLVGVPVQDGAGRLGCEMGPSAYRTAGIARALSDLGHGVTDLGNITPLP
QRPMAHGNAALKFLPEVAGWTAALSKVAYEASAGRDAMPIFLGGDHSLAAGTLTGLARRA
AGMGRPLFVLWLDAHPDFHTLETSESGNLHGVPMAYATGRAGFDGYFPPPPGLLDPANVC
MMGIRSVDPAERRALETSGIAIHDMRKIDEHGIVALLRPFLERVAAADGLLHVSLDVDFL
DPGIAPGVGTTVPGGATFREAHLVMEMLHDSGLVSSVDLVELNPFLDERGRTAILMVELL
ASLMGRRVLDYPTRSF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccataagaccaagacgaagcaatgccggctggtcggcgtgccggtgcaggat
ggcgcggggcggcttggctgcgagatggggcccagcgcctaccgcaccgccggcatcgcg
cgggcgctgtcggacctcggccacggcgtgaccgacctcggcaatatcaccccgctgccg
cagcggccgatggcgcatggcaacgccgcgctgaagttccttccggaggtggcgggctgg
accgccgccctgtccaaggtggcctatgaggcgagcgccgggcgggacgccatgccgatc
ttcctgggtggcgaccacagccttgccgccggcaccctgaccgggctggcgcggcgggcc
gccgggatggggcgcccgctgttcgtgctgtggctggacgcccatccggacttccacacg
ctggaaacgtctgagagcggcaatctgcatggcgtgccgatggcctatgccaccgggcgc
gccggtttcgacggctatttcccaccgccgccgggcctgcttgatcccgccaatgtctgc
atgatgggcatccgcagcgtcgatccggccgagcggcgggcgctggagacttcgggcatc
gccatccatgacatgcgcaagatcgacgagcatggcatcgtcgccctgctgcgcccgttc
ctggagcgggtggcggcggcggacgggctgctgcatgtcagcctggatgtcgatttcctc
gatcccggcatagcacccggcgtcggcaccacggttcccggcggcgccaccttccgcgag
gcgcatctggtcatggagatgctgcacgacagcggtctggtcagcagcgtcgatctggtg
gaactgaaccccttcctcgacgaacgcgggcggaccgcgatcttgatggtggaactgctg
gcgagcctgatggggcgccgcgttctcgattacccgacccgcagcttttga

DBGET integrated database retrieval system