KEGG   Azospirillum sp. B510: AZL_b05450Help
Entry
AZL_b05450        CDS       T01169                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
azl  Azospirillum sp. B510
Brite
Enzymes [BR:azl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AZL_b05450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510b:625298..625822
Genome map
AA seq 174 aa AA seqDB search
MGAQPMPDPICKAAIELVKHFEGLSLDAYLCPAGIPTIGYGHTAGVSLGQRITAEKAEAL
LADDLAAAAAAVDALVTVPLTGGQRGALASFVFNLGRGNFQSSTLLKRLNGGDPEGAAGE
FGRWVNATVQGRKTKLPGLVKRREAETLLFRRNLFLTRMAAADPMPQAVDTPAA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggagcacaaccgatgcccgatccgatctgcaaggccgccatcgagcttgtgaagcat
ttcgagggcctgtcgctcgacgcctatctctgcccggccggcatcccgaccatcggttac
ggccacaccgccggcgtgtcgctgggccagcgcatcaccgccgaaaaggccgaggctctg
ctggcggacgacctcgccgccgccgccgccgcggtcgatgcgctggtgacggtgccgctg
accggcggccagcgcggcgcgctcgccagcttcgtcttcaatctgggccggggcaatttc
caatcctcgaccctgctgaaacgcctcaacggcggcgatcccgagggggcggccggcgag
ttcggccgctgggtcaacgccaccgtccagggccggaaaaccaagctccccggtctggtg
aagcgccgggaggccgaaaccctgctgtttcgccgcaacctgttcctgaccaggatggcg
gcggcggacccgatgccgcaggccgtcgacacgcctgccgcgtga

DBGET integrated database retrieval system