KEGG   Azospirillum sp. B510: AZL_c00300Help
Entry
AZL_c00300        CDS       T01169                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
azl  Azospirillum sp. B510
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AZL_c00300 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_c00300 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AZL_c00300 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AZL_c00300 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZL_c00300 (adh)
   00626 Naphthalene degradation
    AZL_c00300 (adh)
Enzymes [BR:azl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AZL_c00300 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510c:complement(35200..36240)
Genome map
AA seq 346 aa AA seqDB search
MKAVVYEAFSAPPRIMTVPDPTPEPHGVVVKVMATGVCRSDWHGWVGHDTDIQLPHVPGH
ELAGIVEAVGRDVTKWRIGDRVTVPFVGGCGACPECHSGNHQVCDRQFQPGFTHWGSFAQ
YVGLHQADINLVRLPETMDFTTAASLGCRFVTSFRAVVDQGKASAGQWVAVHGCGGVGLS
AVMIANALGANVVAVDISEDKLALARALGAAATVNAAEVPQVAEAVIEITRGGAHVSLDA
LGHPTTCFNSISNLRKRGKHVQVGLMLAENSTPAIPMDRVIAKELEILGSHGMQAHRYDA
MMEMMRCGKLAPEKLIGRTISLEQSIDALMGMDRFEVAGVTVVTEF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtggtctacgaggcgttttccgcaccccctcgcatcatgaccgttcccgac
ccgacaccggagccgcatggcgtcgtcgtcaaggtgatggcgaccggggtctgccgcagc
gactggcatggctgggtcggtcacgacaccgacatccagcttccccatgtgccgggccac
gagctggccggcatcgtcgaggcggtcgggagggacgtgacgaaatggcggatcggcgac
cgggtgacggtgccgttcgtcggcggctgcggcgcctgtcccgaatgccattccggcaac
catcaggtgtgcgaccggcagttccagcccggcttcacccattggggctccttcgcccaa
tatgtcggcctgcatcaggcggacatcaatctggtgcggctgccggagacgatggatttc
accaccgccgccagcctcggctgccgcttcgtgacctccttccgcgccgtcgtcgatcag
ggcaaggcgtcggccggccaatgggtggcggtgcatggctgcggcggcgtcggcctgtcg
gcggtgatgatcgccaacgcgctgggcgccaacgtcgtcgccgtcgacatctccgaagac
aagctcgcgctggcccgcgcgctgggcgccgccgccacggtgaacgcggcggaggtgccg
caggtcgccgaggcggtcatcgagatcacgcgcggcggcgcccatgtctcgctcgacgcg
ctggggcacccgaccacctgcttcaactcgatcagcaatctgcgcaagcgcggcaagcat
gtgcaggtcgggctgatgctggccgagaacagcaccccggccattccgatggaccgggtc
atcgccaaggaactggaaatcctcggcagccacggcatgcaggcccaccgctatgacgcg
atgatggagatgatgcgctgcggcaagctggcgcccgagaagctgatcggcaggacgatc
agcctggagcagtcgatcgacgccctgatgggcatggacaggttcgaggtcgccggcgtc
accgtggtgaccgaattctga

DBGET integrated database retrieval system