KEGG   Azospirillum sp. B510: AZL_c02030Help
Entry
AZL_c02030        CDS       T01169                                 

Definition
nitrite reductase (NO-forming) (EC:1.7.2.1)
Orthology
K00368  
nitrite reductase (NO-forming) [EC:1.7.2.1]
Organism
azl  Azospirillum sp. B510
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:azl00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510c:complement(248802..249869)
Genome map
AA seq 355 aa AA seqDB search
MKTKISLVTVSAAALMLLSGIGAASAADTLYADPKVKQPTLSVVQDPAAVPAPEKAGKRA
PKTQKVSLTTTEVESKLDDGTSYTYWTFNNTVPGPMVRVRVGDTVDVSITNAPESTMNHS
VDFHAATGFLGGGQITQVEPGQTKAFSFKALTPGVYVYHCATPMVVHHISKGMYGLIVVE
PEGGLPPVDHEFYVMQQEIYATKAKNLANAEDDYDGLVNERPSYLVFNGTVGALTKDKPL
KAKVGETVRLFFGVGGPNLTSSFHVIGEIFDKVYTLGGLESEPAKGIQTVTVAPGGATMV
EFKVDYPGKYALVDHALSRATKGLIGILEVEGKADDGIILDKTGDSRKQLGEMQH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaagatctccctcgtcaccgtcagcgccgccgcgctgatgctcctgtccggg
atcggtgccgcgtcggcggccgacacgctctatgccgatccgaaggtgaagcagcccacg
ctcagcgtcgtgcaggatccggccgccgtgccggccccggaaaaggccggcaagcgggcg
cccaagacccaaaaggtttcgctgacgacgacggaggtcgaatccaagctcgatgacggc
accagctacacctattggaccttcaacaacacggttcccggcccgatggtccgggtgcgg
gtcggcgacacggtcgatgtctcgatcaccaacgcgccggaatcgacgatgaaccactcc
gtcgatttccacgccgcgaccggcttcctcggcggcggccagatcacccaggtggagccg
ggccagaccaaggccttcagcttcaaggcgctgacgcccggcgtctatgtctatcactgc
gccacgccgatggtcgtccatcacatctccaagggaatgtacggcctgatcgtggtggaa
ccggaaggcggcctgccgccggtcgatcacgaattctatgtgatgcagcaggaaatctac
gccaccaaggccaagaatctggcaaatgccgaggatgactatgacggtctcgtcaacgag
cgcccgagctatctggtcttcaacggcacggtcggcgccctgaccaaggacaagccgctg
aaagccaaggtcggcgagacggtgcgcctgttcttcggcgtcggcggcccgaacctgacc
tcctccttccatgtgatcggcgagatcttcgacaaggtctataccctgggtggcctggaa
agcgagccggccaaaggcatccagaccgtcaccgtcgcccccggcggcgccacgatggtg
gagttcaaggtggattatcccggcaaatacgccctggtcgaccatgcgctgagccgcgcc
accaagggcctgatcggcatcctggaggtcgagggcaaggccgacgacggcattatcctc
gacaagaccggcgacagccgcaagcagctcggcgaaatgcagcactga

DBGET integrated database retrieval system