KEGG   Azospirillum sp. B510: AZL_c03470Help
Entry
AZL_c03470        CDS       T01169                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
azl  Azospirillum sp. B510
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:azl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:azl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:azl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510c:425051..426808
Genome map
AA seq 585 aa AA seqDB search
MRNFLLALASATILSSAANAAVIYPLDRATVLVGSPFDLKVEFDKVVKPEDVKVTVNGQD
YEAVFGRKASFVAEEKGDKGKLLGSALLLRDLRIETPGKYKVEVVAGDERKSVDWDVYPT
AATPKARNIIFLLGDGMSVAHRTGARIMSKGMTEGKANGRLYMDDVPPVAFIGTSSTSSI
ATDSANTMSAYMTGHKSAVNALGVYADRTPDSLDDPKVETIAEALRRKTKKSVGIVTTAE
VEDATPAALVAHTRKRSDKAEIVEMLYNVKPDVLLGGGSAYFLAKSVPGSKRKDDKDYIQ
LFKDAGYTLATDKKELEAASGATSGKLLGLFHPANIDVTLDREFLKKGTVDKYPNQPGLV
EMTKAALGQVSKNPEGFFLMIEGASIDKMSHPLDWERALFETIEFDKAVGLARDFAAKNP
DTLIIVTGDHTHGVSLIGTVDDDKPGTEMREKVGTYAAAGFPNYEDKDGDGYPDRVDVSR
RLFMAANNGPDHYETFRPKMEGPFVPAIQNEKKEYVANEAYKSVPGAVFVQGNIPRDEDS
GVHAVDDVVLQAIGPGADGLRGYMEQSDVYKVLADVFALGTPKAP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaattttctcctcgccctggcatccgcgacaattctgagtagtgccgcgaatgcc
gccgtcatctacccgctcgaccgggccacggtgcttgtcggttcgcccttcgacctcaag
gtcgaattcgacaaggtggtcaagcccgaggacgtgaaggtcacggtgaacggccaggac
tatgaggccgtcttcggcaggaaggcgagcttcgtcgcggaggagaagggcgacaagggc
aagctgctgggttcggccctgctcctgcgcgatctgcggatcgagactcccggcaagtac
aaggtcgaggtggtggccggcgacgaacggaaatcggtcgactgggatgtctaccccacg
gctgcgaccccgaaggccaggaacatcatcttcctgctgggtgacggcatgtccgtcgct
caccgcaccggcgcgcggatcatgtccaagggcatgaccgaaggcaaggccaatggccgg
ctctacatggacgatgtgccgcccgtcgccttcatcggcacctcttcgacctcgtcgatc
gcgacggacagcgccaacacgatgtccgcctacatgaccggtcacaaatcggcggtgaac
gcgctcggcgtctatgccgaccgcacgcccgacagcctggacgatcccaaggtcgagacc
atcgccgaggcgctgcgccgcaagacgaagaagtcggtcggcatcgtcaccaccgccgag
gtcgaggacgccacgccggccgccctggtcgcccacacgcgcaagcgcagcgacaaggcc
gagatcgtcgagatgctctacaacgtgaagcccgacgtcctgctcggcggcggctccgcc
tatttcctggccaagtccgtccccggttccaagcgcaaggacgacaaggactacatccag
ctgttcaaggatgccggctatacgctggcgaccgacaagaaggagctggaagcggcatcc
ggcgcgacctccggcaagctgctcggcctgttccatcccgccaacatcgacgtgacgctg
gaccgcgagttcctgaagaaggggacggtggacaagtatcccaaccagccgggtctggtc
gagatgaccaaggccgccctcggccaggtgtcgaagaatccggaaggcttcttcctcatg
atcgaaggcgcttcgatcgacaagatgagccatccgctcgattgggaacgcgccctgttc
gagacgatcgaattcgacaaggccgtcggtctcgcccgtgacttcgcggcgaagaacccc
gatacgctgatcatcgtcaccggcgaccacacccacggcgtctcgctcatcggtaccgtg
gacgatgacaagccgggcacggagatgcgcgagaaggtcggcacctacgccgcagccggc
ttcccgaactacgaggacaaggacggcgacggctatccggaccgcgtcgacgtgtcccgc
cgcctgttcatggccgcgaacaacggccccgatcattacgagaccttccgcccgaagatg
gaggggccgttcgttccggcgatccagaacgagaagaaggaatatgtcgccaacgaggcg
tataaatccgttccgggtgcggtcttcgtccagggcaacatcccgcgcgacgaggacagc
ggcgtccatgcggtcgacgacgtggtcctccaggcgatcggtcccggcgcggacggcctg
cggggctacatggaacagagcgacgtttacaaggtcctggcggacgtcttcgcgctcggt
actccgaaggcgccgtaa

DBGET integrated database retrieval system