KEGG   Azospirillum sp. B510: AZL_c04210Help
Entry
AZL_c04210        CDS       T01169                                 

Gene name
glcB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
azl  Azospirillum sp. B510
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZL_c04210 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZL_c04210 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZL_c04210 (glcB)
Enzymes [BR:azl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZL_c04210 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510c:complement(510845..513004)
Genome map
AA seq 719 aa AA seqDB search
MSNWIRRGGLDIARPLYDFINDEALPGTGVDADRLWTGLDQLLHELAPRNKALLDKRDSL
QAQIDDWHAARRGKLFDPAEYESFLRRIGYLVPEGGDFAVATANVDPEIAYLAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDAIPGAPAAGGYDAARGAQVIAWARKFLDDSVPLA
EGSHADAAGYAVEGGALVVTLKDGGKTGLKDKAAFVGWQGEASAPSAVLLVQNGTHIEIR
IDRDSVIGKSDVAGIADVVLEAALSTIQDCEDSVAAVDAEDKVVAYRNWLGLMKGTLEAS
FPKGDKTIVRKLNPDRVYTTPAGSVTLHGRSLLLVRNVGHLMTIDMVKLSDGSEAPEGIL
DGVFTSLIALHDLKADGGLRNSRAGSVYIVKPKMHGPEEVAFTDELFGRVEDLLGIARNT
LKVGIMDEERRTTVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPVVRKAAMKAT
KWISAYEDNNVDVGLRAGLKGRAQIGKGMWAMPDLMADMLVAKIGHPKAGANTAWVPSPT
AATLHATHYHAVNVAEVQDQLAKRQAAALSDILTIPLADRPNWSEDEIRQELENNAQGIL
GYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGICTEAQVMEVMKRMA
AVVDKQNAGDPLYKPMAGDFDGSIAFQAACDLVFKGRVQPNGYTEPVLHARRRQVKAAL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactggatccgccgcggtggcctcgacatcgcccgaccgctgtacgacttcatc
aatgacgaggcgctgccggggaccggtgtcgacgccgaccgtctctggaccggcctcgac
cagctcctgcacgagctggcgccgcgcaacaaggccctgctcgacaagcgcgacagcctg
caggcgcagattgatgactggcatgccgcccgtcgcggcaagctcttcgatccggccgaa
tacgaatccttcctgcgccggatcggctatctggtgccggaaggtggcgacttcgccgtc
gccaccgccaatgtcgatccggagatcgcctatctcgccggtccccagctggtggtgccg
atcaccaatgcccgctatgccctgaacgccgccaacgcccgctggggcagcctgtatgac
gcgctgtacggcaccgacgccatccccggcgccccggcggccggcggctatgacgccgcc
cgtggcgcgcaggtgatcgcctgggcccgcaagttcctcgacgacagcgttccgctggcc
gagggcagccatgccgacgccgcgggctatgcggtcgagggcggtgcgctggttgtgacg
ctgaaggacggcggcaagaccggcctgaaggacaaggccgccttcgtcggctggcagggc
gaggcgtcggcgccgtcggcggtgctgctggtccagaacggtacccacatcgaaatccgc
atcgaccgcgacagtgtcatcggcaagagcgatgtcgccggcatcgccgacgtggtgctg
gaagccgcgctgtccaccattcaggactgcgaggattccgtcgccgccgtcgatgcggag
gacaaggtcgtcgcctaccgcaactggctcggcctgatgaagggcacgctggaggccagc
ttccccaagggcgacaagaccatcgtccgcaagctgaaccccgaccgcgtctacaccacc
ccggccggaagcgtcaccctgcatggccgcagcctgctgctggtccgcaatgtcggccac
ctgatgaccatcgacatggtcaagctgtccgatggcagcgaggcgccggaaggcatcctc
gacggcgtcttcacctcgctgatcgccttgcatgatctgaaggctgatggggggctgcgc
aacagccgcgccggctcggtctacatcgtgaagccgaagatgcatggccccgaagaggtc
gccttcaccgacgagctgttcggccgggtcgaggatctgctgggtatcgcccgcaacacc
ctcaaggtcggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggaatgcatc
cgcgccgccaaggaccgcgttgtcttcatcaacacgggtttcctcgaccgcaccggcgac
gagatccacacctcgatggaggccggaccggtcgtccgcaaggcggcgatgaaggccacc
aagtggatttccgcctatgaggacaacaatgtcgatgtcggcttgcgcgccgggctgaag
ggccgcgcccagatcggcaagggcatgtgggcgatgccggacctgatggccgacatgctg
gtcgccaagatcggccacccgaaggccggcgccaataccgcctgggtgccgtcgccgacc
gccgccaccctgcacgccacccactatcacgcggtgaatgtggccgaggtgcaggaccag
ctggccaagcgtcaggccgccgccctgtccgacatcctgaccatcccgctcgccgaccgc
cccaactggtcggaggacgaaatccggcaggagttggagaacaacgcccagggcatcctc
ggctatgtggtgcgctggatcgaccagggtgtgggctgttccaaggtgccggacatccat
gatgtcgggctgatggaggaccgcgccaccctgcgcatctccagccagcacatcgccaac
tggctgcatcacggcatctgcaccgaggcccaggtgatggaggtcatgaagcgcatggcc
gccgtcgtcgacaagcagaatgccggcgatccgctctacaagccgatggccggcgatttc
gacggcagcatcgccttccaggctgcctgcgatctggtgttcaagggccgcgtccagccg
aatggctacaccgagccggtgctgcatgcgcgtcgccgtcaggtgaaggcggcactgtaa

DBGET integrated database retrieval system