KEGG   Azospirillum sp. B510: AZL_c04210Help
Entry
AZL_c04210        CDS       T01169                                 

Gene name
glcB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
azl  Azospirillum sp. B510
Pathway
azl00620  Pyruvate metabolism
azl00630  Glyoxylate and dicarboxylate metabolism
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01200  Carbon metabolism
Module
azl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZL_c04210 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZL_c04210 (glcB)
Enzymes [BR:azl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZL_c04210 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAI75714
RhizoBase: AZLc04210
UniProt: D3P4Y5
Position
pAB510c:complement(510845..513004)
Genome map
AA seq 719 aa AA seqDB search
MSNWIRRGGLDIARPLYDFINDEALPGTGVDADRLWTGLDQLLHELAPRNKALLDKRDSL
QAQIDDWHAARRGKLFDPAEYESFLRRIGYLVPEGGDFAVATANVDPEIAYLAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDAIPGAPAAGGYDAARGAQVIAWARKFLDDSVPLA
EGSHADAAGYAVEGGALVVTLKDGGKTGLKDKAAFVGWQGEASAPSAVLLVQNGTHIEIR
IDRDSVIGKSDVAGIADVVLEAALSTIQDCEDSVAAVDAEDKVVAYRNWLGLMKGTLEAS
FPKGDKTIVRKLNPDRVYTTPAGSVTLHGRSLLLVRNVGHLMTIDMVKLSDGSEAPEGIL
DGVFTSLIALHDLKADGGLRNSRAGSVYIVKPKMHGPEEVAFTDELFGRVEDLLGIARNT
LKVGIMDEERRTTVNLKECIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPVVRKAAMKAT
KWISAYEDNNVDVGLRAGLKGRAQIGKGMWAMPDLMADMLVAKIGHPKAGANTAWVPSPT
AATLHATHYHAVNVAEVQDQLAKRQAAALSDILTIPLADRPNWSEDEIRQELENNAQGIL
GYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGICTEAQVMEVMKRMA
AVVDKQNAGDPLYKPMAGDFDGSIAFQAACDLVFKGRVQPNGYTEPVLHARRRQVKAAL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactggatccgccgcggtggcctcgacatcgcccgaccgctgtacgacttcatc
aatgacgaggcgctgccggggaccggtgtcgacgccgaccgtctctggaccggcctcgac
cagctcctgcacgagctggcgccgcgcaacaaggccctgctcgacaagcgcgacagcctg
caggcgcagattgatgactggcatgccgcccgtcgcggcaagctcttcgatccggccgaa
tacgaatccttcctgcgccggatcggctatctggtgccggaaggtggcgacttcgccgtc
gccaccgccaatgtcgatccggagatcgcctatctcgccggtccccagctggtggtgccg
atcaccaatgcccgctatgccctgaacgccgccaacgcccgctggggcagcctgtatgac
gcgctgtacggcaccgacgccatccccggcgccccggcggccggcggctatgacgccgcc
cgtggcgcgcaggtgatcgcctgggcccgcaagttcctcgacgacagcgttccgctggcc
gagggcagccatgccgacgccgcgggctatgcggtcgagggcggtgcgctggttgtgacg
ctgaaggacggcggcaagaccggcctgaaggacaaggccgccttcgtcggctggcagggc
gaggcgtcggcgccgtcggcggtgctgctggtccagaacggtacccacatcgaaatccgc
atcgaccgcgacagtgtcatcggcaagagcgatgtcgccggcatcgccgacgtggtgctg
gaagccgcgctgtccaccattcaggactgcgaggattccgtcgccgccgtcgatgcggag
gacaaggtcgtcgcctaccgcaactggctcggcctgatgaagggcacgctggaggccagc
ttccccaagggcgacaagaccatcgtccgcaagctgaaccccgaccgcgtctacaccacc
ccggccggaagcgtcaccctgcatggccgcagcctgctgctggtccgcaatgtcggccac
ctgatgaccatcgacatggtcaagctgtccgatggcagcgaggcgccggaaggcatcctc
gacggcgtcttcacctcgctgatcgccttgcatgatctgaaggctgatggggggctgcgc
aacagccgcgccggctcggtctacatcgtgaagccgaagatgcatggccccgaagaggtc
gccttcaccgacgagctgttcggccgggtcgaggatctgctgggtatcgcccgcaacacc
ctcaaggtcggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggaatgcatc
cgcgccgccaaggaccgcgttgtcttcatcaacacgggtttcctcgaccgcaccggcgac
gagatccacacctcgatggaggccggaccggtcgtccgcaaggcggcgatgaaggccacc
aagtggatttccgcctatgaggacaacaatgtcgatgtcggcttgcgcgccgggctgaag
ggccgcgcccagatcggcaagggcatgtgggcgatgccggacctgatggccgacatgctg
gtcgccaagatcggccacccgaaggccggcgccaataccgcctgggtgccgtcgccgacc
gccgccaccctgcacgccacccactatcacgcggtgaatgtggccgaggtgcaggaccag
ctggccaagcgtcaggccgccgccctgtccgacatcctgaccatcccgctcgccgaccgc
cccaactggtcggaggacgaaatccggcaggagttggagaacaacgcccagggcatcctc
ggctatgtggtgcgctggatcgaccagggtgtgggctgttccaaggtgccggacatccat
gatgtcgggctgatggaggaccgcgccaccctgcgcatctccagccagcacatcgccaac
tggctgcatcacggcatctgcaccgaggcccaggtgatggaggtcatgaagcgcatggcc
gccgtcgtcgacaagcagaatgccggcgatccgctctacaagccgatggccggcgatttc
gacggcagcatcgccttccaggctgcctgcgatctggtgttcaagggccgcgtccagccg
aatggctacaccgagccggtgctgcatgcgcgtcgccgtcaggtgaaggcggcactgtaa

DBGET integrated database retrieval system