KEGG   Azospirillum sp. B510: AZL_c05240Help
Entry
AZL_c05240        CDS       T01169                                 

Gene name
cheR
Definition
chemotaxis protein methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:azl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:azl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pAB510c:complement(667094..670054)
Genome map
AA seq 986 aa AA seqDB search
MPPEKVCCIVGIGASAGGLEALQRFFDAVPGDGDLAYVVVQHLSPVHKSLMVDLLAKHTA
MEVVQATDGVPVQRNTVYLLPPGKHLSIEDGRLRLTAKDVGGGMSLPIDIFLTALARDQG
PFAIGLILSGTGSDGTRGLMAIKSAGGFTAVQKPETAQFDGMPRSALATGQIDATLPPEE
LPARLIEHARKALARSPPMRNSGQAGRQRREDGDDPLAQIIAVIRSVTGVDFSHYKLATL
LRRIERRMQGAGLDSMEDYAALLRRNSAETVTLYKEMLIGVTRFFRDEAAFRVLADRVIP
GLLANRSPTDMIRVWVCGCASGEEAYSLAILFAEAQERLGRSVDVKIFATDIDQDSIELA
SLGEYGGAIVEDVSPERLSRFFTTRGDGYVVSRDIRRMVVFAAHNIMRDPPFTKIDLLSC
RNLLIYMDQPLQRKVLSLFQYALRQSGFLFLGTSETLGDLQSDFHTVDSRNKVFQSLRAG
SFRLSRLLVPTVAAPLARHGEDGSSQAMEEGAAIDEAMAALMKAYVPPCLLVNDQMTIMH
VFGDASSLLKVPAGEATLNVLKLLPSSVAMVTGTALSRAFRSGEEFALSNIPVKDREGVV
AISLRVQPYVARKTGRRFALVVLDRANMPPLSMPDSDFDLNADAAERIRGLEQELLSRGE
NLQATIEELETANEELQATNEELLASNEELQSTNEELQSVNEELYSVNAEYQAKVEELTE
ITNDLDNLLRSTEIGTVFLDGDFVIRRFTPAAAGFINIIPRDIGRSIAHLSTKIDHPDFL
ADIRKVFDDQEPVERHVRVHDGRWVLTRILPYLTDKSQIGGVVVTFVDVTATRKAQERLQ
KVLDSLPEHIAVTDRQGRIVMVNAAWRSFAERNGGPAVERCGVGTNYLEVCLSPEAAATD
GIAGAAHDGLRRILDREADDFTIEYPCHSPDERRWFLMHATRLDDHDGGIVVSHINITNR
KLMELQLSRDNEAGAARDGKGHEEAQ
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccggaaaaggtctgttgcatcgtcggcatcggcgcctcggccggcgggctggag
gcgttgcagcgcttcttcgacgcggtgcccggcgacggcgacctcgcctatgtcgtcgtc
cagcatctgtcaccggtgcacaagagcctgatggtcgacctgctggccaagcacacggcc
atggaggtggtgcaggcgaccgacggcgtgccggtccagcgcaacaccgtctatctgctg
ccgccgggcaagcatctgagcatcgaggatggccggctgcggctgaccgccaaggatgtc
ggcggcggcatgagcctgccgatcgacattttcctgaccgcgctggcccgtgaccagggc
cccttcgccatcggcctgatcctgtcgggcaccggctccgacggcacgcgcggcctgatg
gcgatcaagtccgccggcggtttcaccgcggtgcagaagccggagacggcgcagttcgac
ggcatgccgcgcagcgcgctcgccaccgggcagatcgacgccaccctgccgccggaggaa
ctgccggcccgcctgatcgagcatgcgcgcaaggcactggcccgcagccccccgatgcgg
aactccggtcaggcgggccggcagcggcgcgaggatggcgacgacccgctggcccagatc
atcgcggtcatccgttccgtcaccggcgtcgatttctcgcattacaagctggcgaccctg
ttgcgacggatcgaacggcgcatgcagggggccgggctggactcgatggaggattatgcc
gccctgctgcggcggaacagcgccgagacggtcaccctgtacaaggagatgctgatcggg
gtgacccgcttcttccgcgacgaggcggcgttccgtgtcctggccgaccgcgtgatcccc
ggcctgctcgccaaccgcagcccaaccgacatgatccgcgtctgggtctgcggctgcgcc
agcggcgaggaggcctattccctcgccatcctgttcgccgaggcgcaggagcggctgggc
cgcagcgtcgatgtcaagatcttcgccaccgacatcgatcaggacagtatagaactggca
agtctcggcgaatatgggggcgccatcgtcgaggatgtgtcgccggagcggctgtcccgt
ttcttcaccacacggggggatggctatgtggtgtcgcgcgacatccgccgcatggtggtg
ttcgccgcccacaacatcatgcgcgatccgcccttcaccaagatcgacctgctgagctgc
cgcaacctgctgatctacatggatcagccgttgcagcggaaggttctgagcctgttccag
tacgcgctgcgccagagcggcttcctgttcctcggcaccagcgagacgctgggcgacctc
caatcggacttccacaccgtcgacagccgcaacaaggtcttccagagcctgcgcgccggg
tcgttccggctgtcgcggctgctggtgccgacggtcgcggccccgctggcccgccatggc
gaggacgggtcgtcccaggcgatggaggagggagcggccatcgacgaggcgatggcggcg
ctgatgaaggcctatgtgccgccctgcctgctggtcaatgaccagatgaccatcatgcat
gtgttcggcgacgcctcctccctgctgaaggtgccggcgggcgaggcgacgctgaatgtg
ctgaagctgctgccgtcgtcggtcgccatggtgacgggcaccgccctcagccgcgccttc
cgctccggcgaggagttcgcgctgtccaacatcccggtgaaggaccgggagggggtggtg
gcgatcagcctgcgcgtccagccctatgtcgcgcgcaagaccggacgccgtttcgccctg
gtcgtgctggaccgcgccaacatgccgccgctgtcgatgccggattccgacttcgacctg
aatgccgacgccgccgagcgcattcgcgggctggagcaggagctgctgtcgcgtggcgag
aatctacaggcgaccatcgaggagctggaaaccgccaacgaggaattgcaggccaccaac
gaggagctgctggcttccaatgaagaacttcagagcaccaacgaggaactgcaatcggtc
aatgaggaactttactccgtcaatgccgaatatcaggcgaaggtggaggaactgaccgag
atcaccaacgacctcgacaatcttctgcgctccaccgagatcggcacggtgttcctggac
ggcgatttcgtgatccgccgcttcacgccggcggcggccggattcatcaacatcatcccg
cgcgacatcggccgctcgatcgcgcatctgtcgaccaaaatcgaccatcccgacttcctc
gccgacattcgcaaggtgttcgacgatcaggagccggtggagcgccatgtccgcgtgcat
gacggacgctgggtgctgacccgaatcctgccctatctgaccgacaagagccagatcggc
ggcgtggtggtgaccttcgtcgacgtcaccgccaccaggaaggcgcaggagcgcttgcag
aaggtgctggacagtctgccggagcatatcgccgtcaccgaccggcagggccggatcgtc
atggtgaatgccgcctggcggagcttcgccgaacgcaatggcgggccggcggtcgaacgc
tgcggggtcggcaccaattatctggaggtctgcctgtccccggaggctgcggcgaccgat
ggcatcgccggcgcggcgcatgacggtctgcgccgcatcctggaccgcgaggccgatgac
ttcaccatcgaatatccctgccattcgccggatgagcggcgctggttcctgatgcacgcc
acccgtttggacgatcatgacggcggcatcgtcgtcagccatatcaacatcaccaaccgc
aaactgatggagttgcagctgtcacgggacaatgaggcgggcgccgcacgcgacggcaag
ggtcatgaggaagcgcaatga

DBGET integrated database retrieval system